DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym87 and pgam2

DIOPT Version :9

Sequence 1:NP_652041.2 Gene:Pglym87 / 46246 FlyBaseID:FBgn0011270 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001005665.1 Gene:pgam2 / 448157 XenbaseID:XB-GENE-971122 Length:253 Species:Xenopus tropicalis


Alignment Length:251 Identity:165/251 - (65%)
Similarity:194/251 - (77%) Gaps:1/251 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YRIVMVRHGESEWNQKNLFCGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQETLR 106
            :|:|:||||||.|||:|.|||||||.|||||.:||....:|:|:|.:|||:.:||||.||..||.
 Frog     3 HRLVIVRHGESSWNQENRFCGWFDADLSEKGAEEARRGAQAIKEAGMEFDICYTSVLKRAVRTLW 67

  Fly   107 AALKSSEHKKIPVCTTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYY 171
            ..|...:...:||..|||||||||||||||||||||:|.|||:|||||||||.|||.|.:||.||
 Frog    68 YILDGIDQMWLPVVRTWRLNERHYGGLTGLNKAETAEKHGEEQVKIWRRSFDIPPPVMGEDHSYY 132

  Fly   172 ACIVEDPRYKDQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHL 236
            ..|.:|.|||| |..:|.|..||||.||.|.||:|||||.|||..|.||:||||||||||:||||
 Frog   133 KLISKDRRYKD-LTQKELPSCESLKDTIARALPFWNEVIAPQILAGKRVMIAAHGNSLRGIVKHL 196

  Fly   237 ECISDKDIMSLNLPTGIPFVYELDESLKPLATLKFLGDPETVKKAMESVANQGKAK 292
            :.:||..||.||||||||.|||||::|||:..:.||||.|||:||||:||.|||.|
 Frog   197 DGMSDAAIMELNLPTGIPIVYELDDNLKPIKPMSFLGDEETVRKAMEAVAAQGKVK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym87NP_652041.2 gpmA 42..292 CDD:184516 164/249 (66%)
pgam2NP_001005665.1 gpmA 3..252 CDD:184516 164/249 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 176 1.000 Domainoid score I3548
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H56228
Inparanoid 1 1.050 354 1.000 Inparanoid score I2197
OMA 1 1.010 - - QHG61896
OrthoDB 1 1.010 - - D496634at33208
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 1 1.000 - - mtm9531
Panther 1 1.100 - - O PTHR11931
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R933
SonicParanoid 1 1.000 - - X392
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.