DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym87 and bpgm

DIOPT Version :9

Sequence 1:NP_652041.2 Gene:Pglym87 / 46246 FlyBaseID:FBgn0011270 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001002630.1 Gene:bpgm / 436903 ZFINID:ZDB-GENE-040718-375 Length:259 Species:Danio rerio


Alignment Length:251 Identity:127/251 - (50%)
Similarity:172/251 - (68%) Gaps:1/251 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KYRIVMVRHGESEWNQKNLFCGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQETL 105
            ||::.::||||..||::|.||.|.|.||||.|..||...|:.||:...:.|...||:|:|:..|.
Zfish     3 KYKLFLLRHGEGAWNKENRFCSWVDQKLSENGVVEAQECGRLLKENGYQLDQVFTSILSRSIHTA 67

  Fly   106 RAALKSSEHKKIPVCTTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEY 170
            ...|::..|:.:||..:|||||||||.|.|||:||.|...|||:||:||||:|..|||:.:.|.|
Zfish    68 WLVLEAMGHEWVPVTKSWRLNERHYGALIGLNRAEMALNHGEEQVKLWRRSYDITPPPIHESHPY 132

  Fly   171 YACIVEDPRYKD-QLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVK 234
            ||.|..|.||.. .:..||.||:||||..::|.|||||:||||.||.|..|||:|||||.|.::|
Zfish   133 YAEIYNDRRYSTCDVPKEELPKTESLKEVLDRLLPYWNDVIVPVIKSGQTVLISAHGNSCRALLK 197

  Fly   235 HLECISDKDIMSLNLPTGIPFVYELDESLKPLATLKFLGDPETVKKAMESVANQGK 290
            |||.||:.||:::.||||:|.:.||||.|:|:...:.|||...::.|::.|.:|||
Zfish   198 HLEAISETDIVNVTLPTGVPVLLELDEDLRPVKPRQLLGDQAKIQAAIKKVEDQGK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym87NP_652041.2 gpmA 42..292 CDD:184516 126/250 (50%)
bpgmNP_001002630.1 HP 4..253 CDD:299704 124/248 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61896
OrthoDB 1 1.010 - - D496634at33208
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X392
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.