DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym87 and CG7059

DIOPT Version :9

Sequence 1:NP_652041.2 Gene:Pglym87 / 46246 FlyBaseID:FBgn0011270 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_651034.2 Gene:CG7059 / 42626 FlyBaseID:FBgn0038957 Length:267 Species:Drosophila melanogaster


Alignment Length:249 Identity:103/249 - (41%)
Similarity:151/249 - (60%) Gaps:4/249 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RIVMVRHGESEWNQKNLFCGWFDAKLSEKGQQEA-CAAGKALKDAKIEFDVAHTSVLTRAQETLR 106
            |:|::|||||::|.:|.||||.||.|||.|.||| ..|..||..:::||||.::|||:|:::|..
  Fly    20 RLVILRHGESDFNIENKFCGWHDAPLSEFGVQEALTVAIPALVQSELEFDVVYSSVLSRSRQTAE 84

  Fly   107 AALKSSEHKKIPVCTTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYY 171
            ..|.......:|:...|||.|||||.|||..|...|.::|||:|:.|||.:|..|||:::.:.|:
  Fly    85 LILSKLNCAYVPIKEDWRLCERHYGNLTGCRKRVVADRYGEEQVQAWRRGYDCVPPPIDEKNRYF 149

  Fly   172 ACIVEDPRYKDQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHL 236
            ..|..:|.: |.:...|||.:|||.:.::|..|.|.|| ..::..|.|||:..||...|.:|:|:
  Fly   150 YTICSNPIF-DDVPRGEFPLAESLHMCVDRVKPVWKEV-RREVFQGTRVLMCVHGTVARALVQHI 212

  Fly   237 ECISDKDIMSLNLPTGIPFVYELDESLKPLATLKF-LGDPETVKKAMESVANQG 289
            |.||::.|..:|:|..:|.|||.|.....|..... |||.|.:::....||..|
  Fly   213 EGISNEAIEKVNIPNCVPRVYEFDLKTGGLVGAAINLGDQEYIRRKTAQVAAIG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym87NP_652041.2 gpmA 42..292 CDD:184516 103/249 (41%)
CG7059NP_651034.2 HP 19..266 CDD:299704 102/247 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469454
Domainoid 1 1.000 71 1.000 Domainoid score I3351
eggNOG 1 0.900 - - E1_COG0588
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I1611
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D496634at33208
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 1 1.000 - - mtm1064
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X392
109.900

Return to query results.
Submit another query.