DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym87 and pgam1a

DIOPT Version :9

Sequence 1:NP_652041.2 Gene:Pglym87 / 46246 FlyBaseID:FBgn0011270 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_942099.1 Gene:pgam1a / 323107 ZFINID:ZDB-GENE-030131-1827 Length:254 Species:Danio rerio


Alignment Length:251 Identity:164/251 - (65%)
Similarity:199/251 - (79%) Gaps:1/251 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 YRIVMVRHGESEWNQKNLFCGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQETLR 106
            |::|::|||||.|||:|.|||||||.|||.|.|||...|:|||||..|||:.:||||.||..||.
Zfish     4 YKLVLIRHGESCWNQENRFCGWFDADLSETGAQEAKRGGQALKDAGFEFDICYTSVLKRAIRTLW 68

  Fly   107 AALKSSEHKKIPVCTTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYY 171
            ..|.|.:...:||..|||||||||||||||||||||.|.||.:|||||||:|.|||.|::||::|
Zfish    69 IVLDSIDQMWLPVHRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDIPPPSMDEDHDFY 133

  Fly   172 ACIVEDPRYKDQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHL 236
            :.|.:|.||.| |..::.|..||||.||.|.||:||:.||||||:|.|||||||||||||:||||
Zfish   134 SIISKDRRYGD-LTEDQLPSCESLKDTIARALPFWNDEIVPQIKEGKRVLIAAHGNSLRGIVKHL 197

  Fly   237 ECISDKDIMSLNLPTGIPFVYELDESLKPLATLKFLGDPETVKKAMESVANQGKAK 292
            |.:|::.||.||||||||.:||||::|||:..::||||.|||:||||:||.|||||
Zfish   198 EGMSEEAIMELNLPTGIPILYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym87NP_652041.2 gpmA 42..292 CDD:184516 162/249 (65%)
pgam1aNP_942099.1 gpmA 4..253 CDD:184516 162/249 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170595447
Domainoid 1 1.000 183 1.000 Domainoid score I3361
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 354 1.000 Inparanoid score I2211
OMA 1 1.010 - - QHG61896
OrthoDB 1 1.010 - - D496634at33208
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 1 1.000 - - mtm6585
orthoMCL 1 0.900 - - OOG6_101500
Panther 1 1.100 - - O PTHR11931
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R933
SonicParanoid 1 1.000 - - X392
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.