DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym87 and Tigar

DIOPT Version :9

Sequence 1:NP_652041.2 Gene:Pglym87 / 46246 FlyBaseID:FBgn0011270 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_795977.1 Gene:Tigar / 319801 MGIID:2442752 Length:269 Species:Mus musculus


Alignment Length:273 Identity:71/273 - (26%)
Similarity:114/273 - (41%) Gaps:75/273 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KYRIVMVRHGESEWNQKNLFCG-WFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQET 104
            ::.:.::||||:..|::.:..| ..||.|||.|.::|.|||:.|  :.::|..|.:|.|||.::|
Mouse     3 RFALTVIRHGETRLNKEKIIQGQGVDAPLSETGFRQAAAAGQFL--SNVQFTHAFSSDLTRTKQT 65

  Fly   105 LRAALKSSEH-KKIPVCTTWRLNERHYGGLTGLNKAE---TAKKFGEEKVKIWRRSFDTPP--PP 163
            :...|:.|.. |.:.|....||.||.||...|...:|   .||..|||....      |||  ..
Mouse    66 IHGILEKSRFCKDMAVKYDSRLRERMYGVAEGKPLSELRAMAKAAGEECPMF------TPPGGET 124

  Fly   164 ME------KDHEYYAC--IVEDPRYKDQLKP------------EEF-----------PKSESLKL 197
            :|      ||...:.|  |:.....::.:.|            |.|           ||..:|.|
Mouse   125 VEQVKMRGKDFFDFICQLILGKAGQRESVLPGAPGSGLESSLAEVFPVGKHGSLGANPKGGTLGL 189

  Fly   198 TIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGV----VKHLEC----ISDK-DIMSLNLPTGI 253
            ...                   :|:.:||..:|.:    :..|.|    ..|| ::.|:...|||
Mouse   190 AAS-------------------ILVVSHGAYMRSLFGYFLSDLRCSLPGARDKLELSSITPNTGI 235

  Fly   254 P-FVYELDESLKP 265
            . |:.:.:|:.:|
Mouse   236 SVFIIDCEEARQP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym87NP_652041.2 gpmA 42..292 CDD:184516 71/272 (26%)
TigarNP_795977.1 His_Phos_1 6..241 CDD:278716 69/261 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.