DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym87 and Bpgm

DIOPT Version :9

Sequence 1:NP_652041.2 Gene:Pglym87 / 46246 FlyBaseID:FBgn0011270 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_955414.1 Gene:Bpgm / 296973 RGDID:735018 Length:258 Species:Rattus norvegicus


Alignment Length:258 Identity:121/258 - (46%)
Similarity:174/258 - (67%) Gaps:11/258 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KYRIVMVRHGESEWNQKNLFCGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQETL 105
            |:|::::||||.:||::|.||.|.|.||:..|.:||...|:.||....|||:..||:|.|:..|.
  Rat     3 KHRLIILRHGEGQWNKENRFCSWVDQKLNSDGLEEARNCGRQLKALNFEFDLVFTSILNRSIHTA 67

  Fly   106 RAALKSSEHKKIPVCTTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEY 170
            ...|:....:.:||.::|||||||||.|.|||:.:.|...|||:|::||||::..|||:|:.|.:
  Rat    68 WLILEELGQEWVPVESSWRLNERHYGALIGLNREKMALNHGEEQVRLWRRSYNVTPPPIEESHPF 132

  Fly   171 YACIVEDPRYK------DQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSL 229
            :..|..|.|||      |||     |:|||||..:||.||||.|.|.|:|..|..|||:|||||.
  Rat   133 FHEIYNDRRYKVCDVPLDQL-----PRSESLKDVLERLLPYWKERISPEILKGKTVLISAHGNSS 192

  Fly   230 RGVVKHLECISDKDIMSLNLPTGIPFVYELDESLKPLATLKFLGDPETVKKAMESVANQGKAK 292
            |.::||||.|||:||:::.||||:|.:.||||:|:.:...:|||:.|.::.|::.|.:|||.:
  Rat   193 RALLKHLEGISDEDIINITLPTGVPILLELDENLRAIRPHQFLGNQEAIQAAIKKVDDQGKVR 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym87NP_652041.2 gpmA 42..292 CDD:184516 120/255 (47%)
BpgmNP_955414.1 HP 4..253 CDD:416258 118/253 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61896
OrthoDB 1 1.010 - - D496634at33208
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11931
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X392
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.