DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment poe and MPC

DIOPT Version :9

Sequence 1:NP_001260222.1 Gene:poe / 46243 FlyBaseID:FBgn0011230 Length:5322 Species:Drosophila melanogaster
Sequence 2:NP_188566.1 Gene:MPC / 821469 AraportID:AT3G19350 Length:103 Species:Arabidopsis thaliana


Alignment Length:121 Identity:22/121 - (18%)
Similarity:43/121 - (35%) Gaps:53/121 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly  2723 FYRLVLMVRGIANARPQSLAKICVENNYDIV----------------PTLMGIVLELHKVTPTLD 2771
            |.::|.:.||  ::.|..||.:..:...|::                |.:.|::|||.:      
plant     7 FNKVVKVARG--DSPPFDLASLPPKEQRDLIGETLFFMVEELEPQFAPKITGMILELDQ------ 63

  Fly  2772 EPVNIVKRGLCQPETIVHCLVEIMYGFALADPGQVGRMTKYFIDLLKHDASVISHS 2827
                         :.::|.||                ..|.|.:::|....|::||
plant    64 -------------DKVLHLLV----------------TPKAFKEMVKEAMEVLAHS 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
poeNP_001260222.1 ZnF_UBR1 1794..1862 CDD:197698
DZR 3793..3837 CDD:289539
E3_UbLigase_R4 4493..5296 CDD:290481
MPCNP_188566.1 PABP 22..86 CDD:395532 14/98 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D717at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.