Sequence 1: | NP_001260222.1 | Gene: | poe / 46243 | FlyBaseID: | FBgn0011230 | Length: | 5322 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_188566.1 | Gene: | MPC / 821469 | AraportID: | AT3G19350 | Length: | 103 | Species: | Arabidopsis thaliana |
Alignment Length: | 121 | Identity: | 22/121 - (18%) |
---|---|---|---|
Similarity: | 43/121 - (35%) | Gaps: | 53/121 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 2723 FYRLVLMVRGIANARPQSLAKICVENNYDIV----------------PTLMGIVLELHKVTPTLD 2771
Fly 2772 EPVNIVKRGLCQPETIVHCLVEIMYGFALADPGQVGRMTKYFIDLLKHDASVISHS 2827 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
poe | NP_001260222.1 | ZnF_UBR1 | 1794..1862 | CDD:197698 | |
DZR | 3793..3837 | CDD:289539 | |||
E3_UbLigase_R4 | 4493..5296 | CDD:290481 | |||
MPC | NP_188566.1 | PABP | 22..86 | CDD:395532 | 14/98 (14%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D717at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |