DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fbl and AT4G35360

DIOPT Version :9

Sequence 1:NP_524870.1 Gene:fbl / 46234 FlyBaseID:FBgn0011205 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001328325.1 Gene:AT4G35360 / 829689 AraportID:AT4G35360 Length:367 Species:Arabidopsis thaliana


Alignment Length:123 Identity:32/123 - (26%)
Similarity:50/123 - (40%) Gaps:28/123 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 FEEAIQL--ATKGDNRKVDKLVKDIYGGDYNRFGLPGDLVASSF---GQMHLNDKRVSVSR---- 384
            |.|.::|  |...:.::::.||:.|:.|  |.|.|....:|..|   |...|...:..|||    
plant   135 FPEVVRLSDAINDEGKRIENLVRGIFAG--NIFDLGSAQLAEVFSKDGMSFLASCQNLVSRPWVI 197

  Fly   385 EDLANATLVTITNNIGSIARMCALNEKIDRVVFVGN-----FLRVNPISMKLLAYAME 437
            :||.|..           ||......| ..|:||.|     .|.:.|.:.::|...|:
plant   198 DDLDNFQ-----------ARWLKKPWK-KAVIFVDNSGADIILGILPFAREMLRLGMQ 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fblNP_524870.1 Fumble 115..460 CDD:281610 32/123 (26%)
AT4G35360NP_001328325.1 DUF89 49..359 CDD:376673 32/123 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5146
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D865329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.