DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fbl and AT2G17340

DIOPT Version :9

Sequence 1:NP_524870.1 Gene:fbl / 46234 FlyBaseID:FBgn0011205 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_565412.1 Gene:AT2G17340 / 816241 AraportID:AT2G17340 Length:367 Species:Arabidopsis thaliana


Alignment Length:276 Identity:60/276 - (21%)
Similarity:84/276 - (30%) Gaps:85/276 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 GILFADLHNRTECYYYENARDILKSEKQQFNFSQPFPFILVNVGSGVSILAVYGPDNYKRISGTS 310
            |||...|  |.:.......|||.|..|.:                          :|.|.||   
plant   100 GILLCRL--REQVLRELGFRDIFKKVKDE--------------------------ENAKAIS--- 133

  Fly   311 LGGGTFLGLCCLLTGCTSFEEAIQLATKGDNRKVDKLVKDIYGGDYNRFGLPGDLVASSF---GQ 372
                       |.....|..:||:    .|.::::.||:.|:.|  |.|.|....:|..|   |.
plant   134 -----------LFPQVVSLSDAIE----DDGKRLENLVRGIFAG--NIFDLGSAQLAEVFSRDGM 181

  Fly   373 MHLNDKRVSVSR----EDLANATLVTITNNIGSIARMCALNEKIDRVVFVGNFLRVNPISMKLLA 433
            ..|...:..|.|    :||.|.....|..:...            .|:||.|  ....|.:.:|.
plant   182 SFLASCQNLVPRPWVIDDLENFQAKWINKSWKK------------AVIFVDN--SGADIILGILP 232

  Fly   434 YAMEFWSNGTMKGLFLEHEGYFGALGC---------LLQFNGELAAA-------LNDGVEHSIHT 482
            :|.|....|....|..........:.|         |...||:|...       .|.|.:..:..
plant   233 FARELLRRGAQVVLAANELPSINDITCTELTEILSQLKDENGQLLGVDTSKLLIANSGNDLPVID 297

  Fly   483 ESDSASEAAQTSSTAD 498
            .|..:.|.|..||.||
plant   298 LSRVSQELAYLSSDAD 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fblNP_524870.1 Fumble 115..460 CDD:281610 46/220 (21%)
AT2G17340NP_565412.1 DUF89 48..359 CDD:376673 60/276 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5146
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D865329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.