DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fbl and pank4

DIOPT Version :9

Sequence 1:NP_524870.1 Gene:fbl / 46234 FlyBaseID:FBgn0011205 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001120490.2 Gene:pank4 / 100145609 XenbaseID:XB-GENE-1012421 Length:769 Species:Xenopus tropicalis


Alignment Length:358 Identity:136/358 - (37%)
Similarity:201/358 - (56%) Gaps:38/358 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 FGMDIGGTLTKLVYFEPKDITPDEQDREAGILRNIRRYLTKNSAYGKTGHRDTHLQMDNVEIRKR 179
            |.:||||:||||.|:.                 .::..:.|..::..||....|.|:..:.:::.
 Frog    35 FAIDIGGSLTKLAYYS-----------------TVQHKVAKVRSFDHTGKDADHEQLYEISVQEE 82

  Fly   180 -RGSLHFIRFQTTDMGNFLSLAKQKGMAELVTT----VCATGGGAFKFEQDFRDQVNMKLAKFDE 239
             ...||||:|:...:...|...|.    .||.|    :.||||||:||:.....::.:|:.|.||
 Frog    83 ITARLHFIKFENAYIEICLDFIKD----HLVNTETKVIKATGGGAYKFKDLIEKKLGLKVDKEDE 143

  Fly   240 LDTLIKGILFADLHNRTECYYYENARDILKSEKQQFNF--SQP--FPFILVNVGSGVSILAVYGP 300
            :..||||..|...:...|.:.|      :|....:|.|  :.|  ||::|||:||||||:.|...
 Frog   144 MTCLIKGCNFVLKNIPHEAFVY------VKHADPEFRFQTTHPNIFPYLLVNIGSGVSIVKVEAE 202

  Fly   301 DNYKRISGTSLGGGTFLGLCCLLTGCTSFEEAIQLATKGDNRKVDKLVKDIYGGDYNRFGLPGDL 365
            |.::||.|:|:|||||.||..|||....|:|.:|||.||.:..||.||||||||.|...||.|:|
 Frog   203 DKFERIGGSSIGGGTFWGLGALLTKTKRFDELLQLAAKGHHTNVDMLVKDIYGGAYQILGLTGNL 267

  Fly   366 VASSFGQMHLNDKRVSVSREDLANATLVTITNNIGSIARMCALNEKIDRVVFVGNFLRVNPISMK 430
            :|||||:....||  ..|:||:|.:.|..|:|:||.:|.:.|....:.:|.|.|.|:|.:|::|.
 Frog   268 IASSFGKSATIDK--DFSKEDMAKSLLHMISNDIGQLACLYAKQHNLSQVYFGGFFIRGHPVTMH 330

  Fly   431 LLAYAMEFWSNGTMKGLFLEHEGYFGALGCLLQ 463
            .::|::.|:|.|.::.|||.||||.|.:|..|:
 Frog   331 TISYSINFFSKGEVQALFLRHEGYLGTIGAFLK 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fblNP_524870.1 Fumble 115..460 CDD:281610 134/353 (38%)
pank4NP_001120490.2 PLN02902 15..769 CDD:215489 136/358 (38%)
Fumble 35..360 CDD:281610 134/353 (38%)
DUF89 447..760 CDD:280170
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D865329at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.