DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fbl and pank3

DIOPT Version :9

Sequence 1:NP_524870.1 Gene:fbl / 46234 FlyBaseID:FBgn0011205 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_001107378.1 Gene:pank3 / 100135204 XenbaseID:XB-GENE-991062 Length:370 Species:Xenopus tropicalis


Alignment Length:355 Identity:224/355 - (63%)
Similarity:277/355 - (78%) Gaps:3/355 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SMPWFGMDIGGTLTKLVYFEPKDITPDEQDREAGILRNIRRYLTKNSAYGKTGHRDTHLQMDNVE 175
            |.|||||||||||.||.||||.|||.:|:..|...|::||:|||.|.|||.||.||.||::.::.
 Frog    10 SFPWFGMDIGGTLVKLAYFEPIDITAEEEQEEVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLT 74

  Fly   176 IRKRRGSLHFIRFQTTDMGNFLSLAKQKGMAELVTTVCATGGGAFKFEQDFRDQVNMKLAKFDEL 240
            :..|||:||||||.|.|:..|:.:|:.|..:.|.|.:|||||||:|||::||...|::|.|.|||
 Frog    75 LFGRRGNLHFIRFPTQDLPTFIHMARDKNFSTLHTVLCATGGGAYKFEEEFRMIGNLQLHKVDEL 139

  Fly   241 DTLIKGILFAD---LHNRTECYYYENARDILKSEKQQFNFSQPFPFILVNVGSGVSILAVYGPDN 302
            |.|:||:|:.|   .:.:.||||:|||....:.:|..||...|:|.::||:|||||||||...|:
 Frog   140 DCLVKGLLYIDSLSFNGQAECYYFENASHPERCQKMPFNLDDPYPLLVVNIGSGVSILAVNSKDS 204

  Fly   303 YKRISGTSLGGGTFLGLCCLLTGCTSFEEAIQLATKGDNRKVDKLVKDIYGGDYNRFGLPGDLVA 367
            |||:.|||||||||||||.|||||.|||||:::|:.||:...||||:|||||||.||||||..||
 Frog   205 YKRVCGTSLGGGTFLGLCSLLTGCESFEEALEMASAGDSTNADKLVRDIYGGDYERFGLPGWAVA 269

  Fly   368 SSFGQMHLNDKRVSVSREDLANATLVTITNNIGSIARMCALNEKIDRVVFVGNFLRVNPISMKLL 432
            ||||.|...|||.|||:||||.||||||||||||||||.|:||||::|:|||||||||.:|||||
 Frog   270 SSFGNMIYKDKRESVSKEDLARATLVTITNNIGSIARMSAVNEKINKVIFVGNFLRVNTLSMKLL 334

  Fly   433 AYAMEFWSNGTMKGLFLEHEGYFGALGCLL 462
            |||:::||||.:|.|||||||||||:|.||
 Frog   335 AYALDYWSNGQLKALFLEHEGYFGAVGALL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fblNP_524870.1 Fumble 115..460 CDD:281610 218/347 (63%)
pank3NP_001107378.1 Fumble 14..362 CDD:367584 218/347 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 478 1.000 Domainoid score I422
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 483 1.000 Inparanoid score I1420
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D326140at33208
OrthoFinder 1 1.000 - - FOG0001277
OrthoInspector 1 1.000 - - otm48214
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R888
SonicParanoid 1 1.000 - - X986
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.090

Return to query results.
Submit another query.