DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn28F

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_524957.2 Gene:Spn28F / 49807 FlyBaseID:FBgn0028987 Length:375 Species:Drosophila melanogaster


Alignment Length:427 Identity:121/427 - (28%)
Similarity:209/427 - (48%) Gaps:72/427 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    84 SKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTS 148
            :..:.|||..|||.|| .:|..:|:..||||:..|.:|..:||...|.|::..|.|.....::.:
  Fly    11 TSVSCRFADDFYQLLA-KENAANNLISSPLSVEIALSMAYMGARAKTAQEMRNVLKLPDDKKEVA 74

Human   149 DQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKENAEQ 213
            .:.....:||..|     .|.:.|..|||::.:|......:|..:.:..:.|:.:.:|..: ..:
  Fly    75 AKYKDLLSKLEGR-----EKVATLSLANRIYVNKKFQLVPSYNQMVKDSFMAEAEAIDIVD-PNK 133

Human   214 SRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKVLRMALERPQGLPLALQLTPFFFK 278
            :.:.:|.||.|:|.|:|.|::.|..::::.::|| |.||||                        
  Fly   134 ASSIVNNWVDNQTRGKIKDLVSSNDMSKMELIVL-NAIYFK------------------------ 173

Human   279 WRDRSPERANGLPKATQGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRVAE-GTQV 342
                             |.|:.||:|:.|:|..|..:|.:|....||.....||....:| |.::
  Fly   174 -----------------GQWEYKFNPKLTKKRNFRVSDQKSVPVEMMSLFQSFRAAHDSELGAKI 221

Human   343 LELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFSLKEQ 407
            :|||::...::|::.||.....|:::||::.     .:..:|.:|.:.:.:|:|:||....|.:.
  Fly   222 IELPYRNSSLSMLIFLPDQVDGLSELEKKIV-----GFKPKLSKMDVTLRLPKFKIEFFAQLNKV 281

Human   408 LQDMGLVDLFSPEKSKLPGIVAEGRD-----DLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRS 467
            |..||:.|.|  |||      |:.:|     :::|....||||:||||||:||||:||::....|
  Fly   282 LVAMGIQDAF--EKS------ADFKDLVENSNVHVKKVIHKAFIEVNEEGAEAAAATALLFVRYS 338

Human   468 --LNPNRVTFKANRPFLVFIREVPLNTIIFMGRVANP 502
              :..:::.|.|:.||...||:  ..||.|.|....|
  Fly   339 MPMPSSQMVFNADHPFAYVIRD--RETIYFQGHFVKP 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 121/427 (28%)
Spn28FNP_524957.2 SERPIN 14..370 CDD:238101 120/419 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.