DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn42Da

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster


Alignment Length:428 Identity:125/428 - (29%)
Similarity:203/428 - (47%) Gaps:69/428 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    82 ELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEK 146
            |.::..:.|:...|..|:..| ..:||..||.||.|..||.:|||.|:|..||.:..   .::..
  Fly    40 EFARRLALFSINVYGKLSGQK-PGENIVFSPFSIQTCAAMARLGAENETATQLDQGL---GLASS 100

Human   147 TSDQI-HFFFAKLNCRLYRKANKSSKLVS-ANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKE 209
            ..:|| |.|...|      .|.:.|:::. ||::|........:.:..:....:.:..|.:||.:
  Fly   101 DPEQIAHSFHQVL------AAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSK 159

Human   210 NAEQSRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKVLRMALERPQGLPLALQLTP 274
            |. |:.|.||.||..:|...|.|::|::.:|..:.|||||.|:||                    
  Fly   160 NV-QAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFK-------------------- 203

Human   275 FFFKWRDRSPERANGLPKATQGLWKSKFSPENTRKELFYKADGE-SCSASMMYQEGKFRYRRV-A 337
                                 |.|:.:|:...||.:.|: .||| :....||..:.:|||..: |
  Fly   204 ---------------------GTWQHQFAKHLTRPDTFH-LDGERTVQVPMMSLKERFRYADLPA 246

Human   338 EGTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGF 402
            .....||||:|..|::|:::||..:..|..:|::|....|.:....|.|..:.:.:|||:.|...
  Fly   247 LDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVALKLPRFKAEFQV 311

Human   403 SLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRS 467
            .|.|..|.:|:..:||.:...  |.:.:..:.|.||...||||:||||||:||||:|.:.:..:.
  Fly   312 ELSEVFQKLGMSRMFSDQAEF--GKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKR 374

Human   468 --LNPNR-VTFKANRPF---LVFIREVPLNTIIFMGRV 499
              ::|.. :.|.|:.||   ||..:::||    |.|.|
  Fly   375 AIMSPEEPIEFFADHPFTYVLVHQKDLPL----FWGSV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 125/428 (29%)
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 123/421 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.