DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and nec

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_524851.1 Gene:nec / 45908 FlyBaseID:FBgn0002930 Length:476 Species:Drosophila melanogaster


Alignment Length:418 Identity:97/418 - (23%)
Similarity:186/418 - (44%) Gaps:59/418 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    89 RFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHF 153
            ||::..::.:..|:: ..|:..||.|:....|:....:...|.::|.:..:|...:...:.....
  Fly   109 RFSSELFKEIIKSQS-QQNVVFSPFSVHALLALIYGASDGKTFRELQKAGEFSKNAMAVAQDFES 172

Human   154 FFAKLNCRLYRKANKSSKLVSANRLFGDKSL-TFNETYQDISELVYGAKLQPLDFKENAEQSRAA 217
            ...      |:|..:.:.|..|.:::.::.| ..|.:|.:.::..:.|..:.:|. :||:.:.|.
  Fly   173 VIK------YKKHLEGADLTLATKVYYNRELGGVNHSYDEYAKFYFSAGTEAVDM-QNAKDTAAK 230

Human   218 INKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKVLRMALERPQGLPLALQLTPFFFKWRDR 282
            ||.||.:.|..:|.|::....::..|..:|||.:||                             
  Fly   231 INAWVMDTTRNKIRDLVTPTDVDPQTQALLVNAVYF----------------------------- 266

Human   283 SPERANGLPKATQGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRVAE-GTQVLELP 346
                        ||.|:.:|:..:|....|...:|.....:||:.:..:....:.| |...|||.
  Fly   267 ------------QGRWEHEFATMDTSPYDFQHTNGRISKVAMMFNDDVYGLAELPELGATALELA 319

Human   347 FKGDDITMVLILPKPEKSLAKVEKELT-PEV-LQEWLDELEEMMLVVHMPRFRIEDGFSLKEQLQ 409
            :|....:|:::||.....|.|:.::|: ||. |......|....:.|.:|:|:.|....:.|.|:
  Fly   320 YKDSATSMLILLPNETTGLGKMLQQLSRPEFDLNRVAHRLRRQSVAVRLPKFQFEFEQDMTEPLK 384

Human   410 DMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVT 474
            ::|:..:|:| .|::..::.:   .:.||....||::.|.|.|:||:|::.......||.|....
  Fly   385 NLGVHQMFTP-NSQVTKLMDQ---PVRVSKILQKAYINVGEAGTEASAASYAKFVPLSLPPKPTE 445

Human   475 FKANRPFLVFIREVPLNTIIFMGRVANP 502
            |.||||| ||....|. :::|:|.|..|
  Fly   446 FVANRPF-VFAVRTPA-SVLFIGHVEYP 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 97/418 (23%)
necNP_524851.1 SERPIN 108..468 CDD:238101 95/413 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.