DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn27A

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_001260143.1 Gene:Spn27A / 45815 FlyBaseID:FBgn0028990 Length:447 Species:Drosophila melanogaster


Alignment Length:513 Identity:125/513 - (24%)
Similarity:226/513 - (44%) Gaps:89/513 - (17%)


- Green bases have known domain annotations that are detailed below.


Human     8 TVTSGKRKVYLLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKI 72
            |...|...|.||||.|...   .|.:|:.:...|        .|..::   |.:..:..|....:
  Fly     2 TKMGGNLAVMLLSLFLSAL---ATGNGNSIPTTT--------TPQGVF---ETRTDKLPGGAASV 52

Human    73 PEATNRRVWE--------LSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACND 129
            |....  :::        .|.::..|:....:.:..::..:.|:.:||.|:....|:....|...
  Fly    53 PSGAG--IYDDIDTFVPFRSDSHDPFSWHLLKTVLQNETADKNVIISPFSVKLVLALLAEAAGAG 115

Human   130 TLQQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSA-NRLFGDKSLTFNETYQDI 193
            | |..:|:....|.....::...|:...||.  ::|.|:..:.:|. .:||.|   :|.||.|..
  Fly   116 T-QTQVELANTQTDIRSQNNVREFYRKTLNS--FKKENQLHETLSVRTKLFTD---SFIETQQKF 174

Human   194 SELV---YGAKLQPLDFKENAEQSRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKV 255
            :..:   |.::::.||| .|.|.:..|||.|.:|.|:||:..::..:.:.. :|::|.|.|||  
  Fly   175 TATLKHFYDSEVEALDF-TNPEAAADAINAWAANITQGRLQQLVAPDNVRS-SVMLLTNLIYF-- 235

Human   256 LRMALERPQGLPLALQLTPFFFKWRDRSPERANGLPKATQGLWKSKFSPENTRKELFYKADGESC 320
                                                   .|||:.:|:  .|.:..|:::..:..
  Fly   236 ---------------------------------------NGLWRRQFA--TTFQGSFFRSKDDQS 259

Human   321 SASMMYQEGKFRYRRVAE-GTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQ--EWLD 382
            .|..|.|...|.|....: ..|:|.||:||.: ::.::||.....:..:.|.|..:.|:  :|  
  Fly   260 RAEFMEQTDYFYYTTSEKLKAQILRLPYKGKN-SLFVLLPYALNGIHDLVKNLENDELKSAQW-- 321

Human   383 ELEEMMLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIV--AEGRDDLYVSDAFHKAF 445
            .:||:.:.|.:|:|..:...:|||.|:.:|:.::|. :.:.|||:.  |:....:.||:...||.
  Fly   322 AMEEVKVKVTLPKFHFDYQQNLKETLRSLGVREIFE-DSASLPGLTRGADVAGKVKVSNILQKAG 385

Human   446 LEVNEEGSEAAASTAVVIAGRSLNPNRV-TFKANRPFLVFIREVPLNTIIFMGRVANP 502
            :.|||:|:||.|:|.|.|..:......: .|..||||:.||.|.....|:|.|:|.:|
  Fly   386 INVNEKGTEAYAATVVEIENKFGGSTAIEEFNVNRPFVFFIEEESTGNILFAGKVHSP 443

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 111/451 (25%)
Spn27ANP_001260143.1 SERPIN 72..440 CDD:238101 107/422 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.