DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn100A

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:384 Identity:85/384 - (22%)
Similarity:151/384 - (39%) Gaps:116/384 - (30%)


- Green bases have known domain annotations that are detailed below.


Human   182 KSLTFNETYQDISELVYGAKLQ---------------PLDFKENAEQSRA--------------- 216
            |:|..|||.|:..:|   ||:.               ||...|||.::.|               
  Fly   301 KNLEENETVQEEEKL---AKIMAAPALTAGEPEKVRLPLQKLENAVKTAAKDGADEIMLALESHL 362

Human   217 ----AINKWVSNKTEGRITDVIPSEAI-----NELTVLVLVNTIYFKVLRMALERPQGLPLALQL 272
                .:|...|...:..||..:.:.:|     ...:.::|.|.:|:   |.:...|         
  Fly   363 PSVSRVNGARSLFQQDDITSALSANSITGRSAGSKSKMLLFNGLYY---RGSWANP--------- 415

Human   273 TPFFFKWRDRSPERANGLPKATQGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRVA 337
               |::.||.|                         .|.|:..:.::..|.||:..|||   :||
  Fly   416 ---FYQLRDGS-------------------------DEFFFMTNEDAVKAPMMHARGKF---QVA 449

Human   338 EGTQ----VLELPFKGDDITMVLILPKPEKSLAKVEKEL-TPEVL----QEWLDELEEMMLVVHM 393
            :..|    ||.||::.....:.::||...:.|:.|..:| |.:.|    |..:.||.     :.|
  Fly   450 DLPQVKARVLSLPYETSRYALCIVLPDETEGLSDVISQLQTSDFLLAKKQFQMKELH-----ISM 509

Human   394 PRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEEGSEAAAS 458
            |:|::|:....:..|:.|||..:||..:::| .:::|. .|::|.:......:.|:|.||.|.:.
  Fly   510 PKFQVEETSRSEAMLKQMGLKKVFSRTEAQL-SLLSED-PDVHVDEIVQFVNVRVDEGGSSANSL 572

Human   459 TAVVIAGRSLN---------------PNRVTFKANRPFLVFIREVPLNTIIFMGRVANP 502
            :|..:..|:.:               |....|:.||||..||.:.....::..|::..|
  Fly   573 SAATMQARTPSVESTVLPVPEPEPELPGVERFEVNRPFAYFIVDCQEQFVLASGKIYTP 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 85/384 (22%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 67/297 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.