DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn77Ba

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster


Alignment Length:506 Identity:115/506 - (22%)
Similarity:195/506 - (38%) Gaps:97/506 - (19%)


- Green bases have known domain annotations that are detailed below.


Human    22 LLIGFWDCVTCHGSPVDICTAKPRD--IPM-----NPMCIYRSPEKKATEDEGSEQKIPEATNR- 78
            ||:|          .:.:|:|.|::  .|:     ||:..:.:|    |..:.....|....:. 
  Fly    14 LLLG----------AIFLCSADPQNNQAPLQLSVGNPLTAFTAP----TAFQSGVSHIQSMRSNF 64

Human    79 ---RVWELSKANSRFATTFYQHLA-DSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFK 139
               .:..:|:....||....|.:: :.:..|.:..:||.|:.:...:...|:..:|..||.:..:
  Fly    65 DTDVLVSISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLR 129

Human   140 FDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYGAKLQP 204
            .:...||.......:.:.||.     ...:.::.:...::..|.......|:|   .:....:||
  Fly   130 INVEDEKLRGAYKVWSSFLNI-----TTSTIEVATLQAIYTGKGYPIKNNYRD---AIQNYNVQP 186

Human   205 LDFKENAEQSRAAINKWVSNKTEGRIT-DVIPSEAINELTVLVLVNTIYFKVLRMALERPQGLPL 268
            ::....:..|...||:..:..|.|.|. .::|.:...  ..:.|::::|||              
  Fly   187 MEVDFYSPDSVIQINEDTNRTTRGLIPYTILPQDVYG--AKMFLLSSLYFK-------------- 235

Human   269 ALQLTPFFFKWRDRSPERANGLPKATQGLWKSKFSPENTRKELFYKADGESC-SASMMYQEGKFR 332
                                       |.||..|:...||:|.|:...||.. ...||.||..|.
  Fly   236 ---------------------------GQWKFPFNKTLTREEPFFSESGEVIGKIPMMVQEANFA 273

Human   333 YRRVAEGTQ--VLELPFKGDD-ITMVLILPKPEKSLAKVEKELTPEVLQEWLDEL--------EE 386
            |....||..  |||||:...| :.|:::|||....|..|...|....|:..|..|        |:
  Fly   274 YVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLRPILQRLAAFRNRASED 338

Human   387 MMLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEE 451
            ..:.|.||:|.....|:||..|..||:.|||....:.|..:    ...|:.....|...:.|:|:
  Fly   339 NEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRM----SSGLFAKLVVHSTKIIVDEQ 399

Human   452 GSEAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRVANP 502
            |:.|.|.|...:|.::..|.   |..||||...|.|.....::|.|:|.||
  Fly   400 GTTAGAVTEAALANKATPPK---FLLNRPFQYMIVEKATGLLLFAGQVRNP 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 104/451 (23%)
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 99/426 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.