DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn53F

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_001036553.1 Gene:Spn53F / 36931 FlyBaseID:FBgn0034195 Length:379 Species:Drosophila melanogaster


Alignment Length:459 Identity:91/459 - (19%)
Similarity:158/459 - (34%) Gaps:137/459 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    84 SKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQL-------------- 134
            ::.||:.....|..:.:|.: |.||..|...|.::.....:|...|..:|:              
  Fly    16 AQKNSQLPDELYAAIVNSFS-NRNIMFSTEMIRSSMLFIYVGVEEDESEQIRKAMHYRGTHLSEY 79

Human   135 ----MEVFKFDTISEKTSDQIHFFFAKLNCRL---YRKANKSSKLVSANRLFGDKSL----TF-- 186
                .::|.........:..:..|:.:.|.::   ||...:.::..:.|..|..:.|    ||  
  Fly    80 KPKTQKIFAMSVKKAPVAKSLTRFYVRQNMKMSTEYRVFMRHTEGRARNIAFAREQLDEVNTFYS 144

Human   187 NETYQDISELVYGAKLQPLDFKENAEQSRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNTI 251
            :|..:.|.::|          ||:          |....::|                 :|||.|
  Fly   145 HEMGEQIGQVV----------KES----------WWKPNSQG-----------------LLVNAI 172

Human   252 YFKVLRMALERPQGLPLALQLTPFFFKWRDRSPERANGLPKATQGLWKSKFSPENTRKELFYKAD 316
            :|.:                                         .|:..|:||.|....|....
  Fly   173 FFNL-----------------------------------------SWERTFNPEATYPREFRVNA 196

Human   317 GESCSASMMYQEGKFRYRRVA--EGTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQE 379
            .:|....||:::.||.:..:.  :.|.|| :||...|:.|:||.|.....||.::.:|....:..
  Fly   197 TKSVMIPMMHEDSKFAFGILGNLKATAVL-VPFSHGDLRMLLIKPDQPDGLAALQMKLQAMNILS 260

Human   380 WLDELEEMMLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKS-----------KLPGIVAEGRD 433
            ....|..|.:.|.:|:|:|.....|....:.||:.|:|.|.||           ::.|::     
  Fly   261 VARNLTMMDVFVGIPKFKIHSDLELSPAFEKMGIKDIFKPSKSFSTLLHRNTNFRIDGVI----- 320

Human   434 DLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVT-FKANRPFLVFIREVPLNTIIFMG 497
                    |....|..|:|. ...||.|.....:...|.|. |.|..||..:|  :...:|.|.|
  Fly   321 --------HVVTFEFQEQGI-GTPSTDVGNGSLTHTFNGVKYFLATHPFAFYI--IDNTSIYFAG 374

Human   498 RVAN 501
            .|.:
  Fly   375 HVTS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 91/459 (20%)
Spn53FNP_001036553.1 SERPIN 25..376 CDD:238101 88/446 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.