DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn47C

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster


Alignment Length:432 Identity:108/432 - (25%)
Similarity:184/432 - (42%) Gaps:72/432 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    83 LSKANSRFATTFYQHLADSKNDND-----NIFLSPLSISTAFAMTKLGACNDTLQQLME--VFKF 140
            ||.:...||...::.|      ||     |:.:||....:|..:..:||...:..:|..  :...
  Fly    11 LSASPIVFARNLFRAL------NDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGV 69

Human   141 DTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPL 205
            ...||........:..:.:|     |.|...|....||:.::.......:.|::...:.|:...|
  Fly    70 SNKSEVAKQHAESWTDECSC-----AKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSL 129

Human   206 DFKENAEQSRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKVLRMALERPQGLPLAL 270
            ::. |.|.|...:|||:...|...:.::...|..|..:.::|||:::|:.               
  Fly   130 NYL-NPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRA--------------- 178

Human   271 QLTPFFFKWRDRSPERANGLPKATQGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRR 335
                   ||....|::.                   |:.:.|:....:....|||.|.|:|||..
  Fly   179 -------KWNKIFPQQL-------------------TQIDDFWINPRQRMEVSMMRQIGQFRYGE 217

Human   336 VAE-GTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLV----VHMPR 395
            ..: .:|:|:|||:..::||::|||.....|.::|::|.    |..::|:....|:    |.:|:
  Fly   218 SKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLG----QLDMNEVAAKSLMKEVDVTIPK 278

Human   396 FRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEEGSEAAASTA 460
            ||||....||..||.||:..:|...::.|..:. |.:....:|:|.||.||.|.|.|.|.|....
  Fly   279 FRIECTVDLKVPLQKMGINSVFDAGQADLSDLF-EMKTPQKISEARHKVFLNVTEFGCEVAPEAE 342

Human   461 VVIAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRVANP 502
            |.......||:|..|||:|||:..||:  ...:.|:|....|
  Fly   343 VQPEVLKKNPDRKFFKADRPFVFAIRD--RKNVYFVGHFVKP 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 108/432 (25%)
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 105/420 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.