DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn43Ad

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_610261.1 Gene:Spn43Ad / 35639 FlyBaseID:FBgn0044011 Length:407 Species:Drosophila melanogaster


Alignment Length:519 Identity:106/519 - (20%)
Similarity:182/519 - (35%) Gaps:153/519 - (29%)


- Green bases have known domain annotations that are detailed below.


Human    18 LLSLLLIGFWDCVTCHGSPVDICTAKPRDIPMNPMCIYRSPEKKATEDEGSEQKIPEATNRRVWE 82
            |||.||:|....:|               :|::...:.|||                        
  Fly     6 LLSALLVGLAIALT---------------LPVDGELLARSP------------------------ 31

Human    83 LSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACND---TLQQLME-------- 136
            .|.:::||.......|..::.| .|:.:|||.|..|.::....:.::   .|:|.:|        
  Fly    32 ASVSSNRFGLRLTTKLGLTQPD-ANVVVSPLLIQAALSLLYAESSSEYGSQLRQALELTHASHPK 95

Human   137 --VFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYG 199
              |..|:|:.......     |.:.|||        :|:|  .|:..:..|||            
  Fly    96 LAVQDFETLLTDLKQS-----AAIGCRL--------RLLS--DLYAQQRFTFN------------ 133

Human   200 AKLQPLDFKENAEQSRAAIN------KWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKVLRM 258
                   |:...|...|.:.      .|.|           .|.|..::....|..:.:  .|..
  Fly   134 -------FRNEFETLAARMGVGCHRLSWES-----------ASNAAQDINYAFLSRSNF--SLGE 178

Human   259 ALERPQGLPLALQLTPFFFKWRDRSPERANGLPKATQGLWKSKFSPENTRKELFYKADGESCSAS 323
            .:..||...||...|||.         ..:|:  ..:..|...|.|..|:...|:..........
  Fly   179 LVSAPQLESLAEHNTPFL---------HVSGV--TFRAPWAWAFDPTETQSINFFAGGNRPRLVD 232

Human   324 MMYQEGKFRYRRV-AEGTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEM 387
            .|:.:.::||..| |...|::|:||...|:.|:::.|.....||::|::|....|.:...:|||.
  Fly   233 AMFGQHRYRYAEVPALDAQLIEVPFATADLRMLIVFPNRPDGLAQLERKLAQSDLHQLRSQLEER 297

Human   388 MLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAF----------- 441
            .:.:.:|:.|:.....||..|:::||..||:.|              :::|:.|           
  Fly   298 KVALTLPKLRVLVHSDLKHVLEELGLAKLFTSE--------------VHLSEVFSSILSSSAPPL 348

Human   442 ----HKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREVPLNTIIFMGRVAN 501
                ....||:.|:|..|..|.:.....|...|    ...|.||...|...  .|::..|.:.:
  Fly   349 GAVVQSGLLELQEDGGNADDSFSFGDLFRRALP----LVINHPFFYAIGNG--KTLLLSGHIVD 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 95/467 (20%)
Spn43AdNP_610261.1 SERPIN 35..404 CDD:238101 94/447 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.