DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn42De

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_610246.3 Gene:Spn42De / 35602 FlyBaseID:FBgn0033115 Length:404 Species:Drosophila melanogaster


Alignment Length:424 Identity:127/424 - (29%)
Similarity:203/424 - (47%) Gaps:65/424 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    88 SRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQL-----MEVFKFDTISEKT 147
            ::||:..:..||.|::.. ||..||.||.|..|:..|||...|..:|     :|......::||.
  Fly    33 AQFASQLFGQLAKSQSGR-NIVFSPSSIRTGLALAYLGAEGSTADELKLGLGLEGAGKTEVAEKL 96

Human   148 SDQIHFFFAKLNCRLYRKANKSS---KLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKE 209
             ||:   .||   ..:.||:...   ||..|||:|..:.....:||||:....:.|..:.::|.:
  Fly    97 -DQL---LAK---GQWEKASGDEDVPKLKYANRIFVTQRFKLTQTYQDLVSKNFAAAAENVNFTQ 154

Human   210 NAEQSRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKVLRMALERPQGLPLALQLTP 274
            .|:.:: .||.||..:|..:|.|:|..|:::..|..:|||.||||.                   
  Fly   155 KADTAK-HINSWVEEQTHQQIKDLIAPESLDADTSAILVNAIYFKA------------------- 199

Human   275 FFFKWRDRSPERANGLPKATQGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRVAE- 338
                  |                |:|.|....|....|....|...|...|.||..||:..:.| 
  Fly   200 ------D----------------WQSSFPDYATYASDFVNHGGRKVSVDTMSQEDYFRFGELTEL 242

Human   339 GTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFS 403
            ..:|:|||:.|.||..::|||:.|:.||.||::|....|.|...:|....:.|.:|:|:.|....
  Fly   243 KAKVVELPYTGTDIVFLIILPQEEQGLAIVEEKLMGIDLNEISSQLRRRKVRVQLPKFKFEFDVP 307

Human   404 LKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSL 468
            |:..|:::|:..|||| .:.|..:. :|.:.|.:|:..|||.:||||:|:.|:.:|.:.::..||
  Fly   308 LQAALEELGIKKLFSP-GANLSSLY-QGSEPLRISEVKHKAIIEVNEKGTTASGATFIKVSVESL 370

Human   469 NPNRVTFK--ANRPFLVFIREVPLNTIIFMGRVA 500
            ......|:  |:.||...|::.. || :|:|.|:
  Fly   371 TIGEEVFEFIADHPFFFAIKDAQ-NT-LFLGHVS 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 127/424 (30%)
Spn42DeNP_610246.3 SERPIN 31..401 CDD:238101 126/421 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
76.890

Return to query results.
Submit another query.