DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn42Dc

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_001246154.1 Gene:Spn42Dc / 35600 FlyBaseID:FBgn0033113 Length:403 Species:Drosophila melanogaster


Alignment Length:411 Identity:112/411 - (27%)
Similarity:192/411 - (46%) Gaps:60/411 - (14%)


- Green bases have known domain annotations that are detailed below.


Human    98 LADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFF-----FAK 157
            |..||:.:.|...||.|:.:|..:..:||...|.::|....:..     ..|:.|..     |.:
  Fly    24 LQQSKDPHINTVFSPASVQSALTLAFMGASGSTAEELRNGLQLG-----PGDRHHIALNFGEFWR 83

Human   158 LNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKENAEQSRAAINKWV 222
            .:|..   .::...|.|.|||:.:.||.....:.:|:...:.:|.:...|.: :|.:...||.||
  Fly    84 TSCNY---GDRGPVLKSVNRLYVNDSLELLTEFNEIAVDFFQSKAEATRFAD-SEGATQLINDWV 144

Human   223 SNKTEGRITDVIPSEAINELTVLVLVNTIYFKVLRMALERPQGLPLALQLTPFFFKWRDRSPERA 287
            ..:||.:||:::.|:|:|..|..:|:|.:|||                                 
  Fly   145 EQETEHKITNLLQSDAVNNETSALLINVLYFK--------------------------------- 176

Human   288 NGLPKATQGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRVAE-GTQVLELPFKGDD 351
                    |.|:..|.||.|..:.|:.........:|||||.|||:..:.: ..:.::||:...:
  Fly   177 --------GKWQKPFMPETTSIDHFHVDRDTHVQVNMMYQEDKFRFAELPQLKARAVQLPYDYSN 233

Human   352 ITMVLILPKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFSLKEQLQDMGLVDL 416
            |.|:::||.....|.::|::|....|.:....|....:.:.:||..||....||:.|..:|:.::
  Fly   234 IHMLILLPNEVNGLQELEQQLNTVDLADIDAALTLQDVEIFLPRMCIEYDVDLKQVLNQLGITEV 298

Human   417 FSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVTFKANRPF 481
            || :|:||.|:.. .:....:|.|.|:.:::|||.||||||.:.:.|....||.|:..|||:.||
  Fly   299 FS-DKAKLDGLFT-SQSGQKISAARHRGYIDVNEAGSEAAAVSFMKIVPMMLNMNKKLFKADHPF 361

Human   482 LVFIREVPLNTIIFMGRVANP 502
            :.:||..  ..:.|.||.:||
  Fly   362 VFYIRNP--QAVFFAGRFSNP 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 112/411 (27%)
Spn42DcNP_001246154.1 SERPIN 7..377 CDD:238101 109/406 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.