DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and CG43366

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_610188.2 Gene:CG43366 / 35519 FlyBaseID:FBgn0263109 Length:2140 Species:Drosophila melanogaster


Alignment Length:545 Identity:98/545 - (17%)
Similarity:192/545 - (35%) Gaps:156/545 - (28%)


- Green bases have known domain annotations that are detailed below.


Human    51 PMCIYRSPEKKATEDEGSEQKIPEAT---NRRVWELSKANSRFATTFYQHLADSK-NDNDNIFLS 111
            |:.:..|||        |.|.:..:|   :..:...::..:..|.::::.:...| :...::.:|
  Fly  1655 PVKLDPSPE--------SSQGLEASTAMMDEDLQSFARLCNELAFSYWRAITSEKISSARSLVIS 1711

Human   112 PLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSA- 175
            |.::::..:|..|||...|..::.|:.|.|   :..:...|..|..:. ....:|:.|....:| 
  Fly  1712 PFALTSMLSMVFLGARGSTSGEMNEILKLD---DMVTFNPHLIFKNIT-NSVEQASDSDIATAAF 1772

Human   176 -NRLFGD----KSLTFNETYQDISELVYGAKLQPLDFKENAEQSRAAINKWVSNKTEGRITDVIP 235
             ..:|.|    |.|.|   :::.::.:|...::.::|....:..|...|..|...|.|::.:.:.
  Fly  1773 VREIFSDRANGKILPF---FKEKTQQLYAGHVEEVNFHVVNDIVRRRTNLLVKRHTMGKVLEYLR 1834

Human   236 SEAINELTVLVLVNTIYFKVLRMALERPQGLPLALQLTPFFFKWRDRSPERANGLPKAT--QGLW 298
            :.::                                       |       .|| |.||  ..|:
  Fly  1835 TNSV---------------------------------------W-------VNG-PLATISANLF 1852

Human   299 KSKFSPENTRK---ELFYKADGESCS------ASMMYQEGKFRYRRVAEGTQVLELPFKGDDITM 354
            ::..|..:|..   |:|::.......      .:::|:.|.......:....|:......:.::.
  Fly  1853 QTDCSHGSTTDRDGEMFFQVHPTVRQRRLVPIPAVLYRSGFLAGYEPSLDATVVSFGRVQNTVST 1917

Human   355 VLILP------KPEKSLAKVEKELTPEVL---QEWLDELEEMM----LVVHMPRFRIEDGFSLKE 406
            |.::|      .|..:|.::|:.|.....   |.|...|..:|    :.|.:|||......:...
  Fly  1918 VYVMPGHQSSISPMDNLDRLERSLVETAFSDKQAWRRLLTSLMDRPGMEVQLPRFSHRSFVNASL 1982

Human   407 QLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSD---------------------------AFHKA 444
            .||.|||..||..:.:.|.|:...|..|:::||                           ...|.
  Fly  1983 GLQKMGLRGLFKSDFADLRGLTGAGNRDIFLSDMIQINTFSTCGEEKISEHHHVEMYPAPPLRKR 2047

Human   445 FLEVNEEGSEAAASTAVVI----------AGRSLN----------------------PNRVTFKA 477
            ..:|:....:|..|:..|:          .||...                      |:....:.
  Fly  2048 NKDVDATDDDAFDSSERVVDFGSLVQESALGRGFYDDLLDPKYLELPLPLRPRQARVPDAPRLRF 2112

Human   478 NRPFLVFIREVPLNTIIFMGRVANP 502
            ::|||.|:|..|...|:||||. ||
  Fly  2113 DKPFLYFVRHNPTGMILFMGRF-NP 2136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 93/526 (18%)
CG43366NP_610188.2 SERPIN 1687..2136 CDD:294093 89/503 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.