DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn28Dc

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_609172.1 Gene:Spn28Dc / 34091 FlyBaseID:FBgn0031973 Length:536 Species:Drosophila melanogaster


Alignment Length:485 Identity:125/485 - (25%)
Similarity:200/485 - (41%) Gaps:112/485 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    75 ATNRRVWELSKANS--RFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEV 137
            ||:.|:     |||  .||....||||:.|..    ..|||||..:.|:..|||...:.::|..|
  Fly   103 ATSDRI-----ANSVLNFANILGQHLANGKTQ----IYSPLSIVHSLALLLLGAKGRSYEELSTV 158

Human   138 FKF-DT-------------ISEKTSDQIHF------FFAKLNCRLYRKANK--SSKLVSANRLFG 180
            |.. ||             :.:.|.:.|..      :.|....|..|:|.:  :.::..||.||.
  Fly   159 FDIPDTSRLHEQFGLMLQDLQQPTREAISAGRPLTDWRASSAMRSNRRAQRPGAHEVHLANGLFT 223

Human   181 DKSLTFNETYQDISELVYGAKLQPLDFKENAEQSRAAINKWVSNKTEGRITDVIPSEAINELTVL 245
            ....|.|..|:.:...||.:.||..||:.:...:|..||.:|:..|:..|.::|.|: |.:.|.:
  Fly   224 QTGYTLNPDYRRVIVEVYASDLQIQDFEGSPATARYNINAYVAQHTKNHIENIIASD-IPQTTRM 287

Human   246 VLVNTIYFKVLRMALERPQGLPLALQLTPFFFKWRDRSPERANGLPKATQGLWKSKFSPENTRKE 310
            :|.|.:|||                                         ..|::.|....||.:
  Fly   288 ILANALYFK-----------------------------------------AFWETDFIESATRPD 311

Human   311 LFYKADGESCS----ASMMYQEGKFRYRRVAE-GTQVLELPFKGDDITMVLILP--KPEKSLAKV 368
            .|| .:||...    ..||...|.:.|....| |.:::.||::|:..||.:|.|  ...:.|..:
  Fly   312 NFY-PNGEGTEPVMRVQMMATGGAYPYHEDHELGCKIIGLPYRGNLSTMYIIQPFKSSVRELMAL 375

Human   369 EKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAE--- 430
            :|.||.:.::..:..:.....:|..|:..:.:..:||..:|.|||..:||..::.|..|...   
  Fly   376 QKRLTADKIESMISRMYRRAALVAFPKMHLTESVNLKTVMQRMGLGGIFSAVQNDLSLIATNEAT 440

Human   431 -----------------------GRDDLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNR 472
                                   .|.||.|.|..||....|||:|:|||||:...:  :...|: 
  Fly   441 RTNALGGNSLQNLEAQRRAGTGGARSDLVVDDIVHKVDFTVNEQGTEAAASSVTYL--KKSGPD- 502

Human   473 VTFKANRPFLVFIREVPLNTIIFMGRVANP 502
            |.|:.:.||:|.:|..|...::|.|.:..|
  Fly   503 VLFRGDTPFMVLVRHDPTKLVLFYGLINEP 532

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 125/485 (26%)
Spn28DcNP_609172.1 SERPIN 111..527 CDD:238101 118/465 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.