DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn28Da

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster


Alignment Length:424 Identity:120/424 - (28%)
Similarity:199/424 - (46%) Gaps:71/424 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    89 RFATTFYQ-HLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIH 152
            :|....|: .|.|:|  ..||..|||.:....:|..:||..:|..:|......    .:....:.
  Fly    16 QFTKQLYRSFLQDNK--QYNIIASPLCVEIGMSMILMGADGNTANELRTALNL----PEDKKNVA 74

Human   153 FFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKENAEQSRA- 216
            ..:.||..:|.| ..|.:.|..|||||.::::..|:.|..:....:.|:.:.:..   |::.:| 
  Fly    75 TIYDKLLTKLER-GKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKL---ADRLKAA 135

Human   217 -AINKWVSNKTEGRITD-VIPSEAINELTVLVLVNTIYFKVLRMALERPQGLPLALQLTPFFFKW 279
             |||.||.::|...:.| :|||:...:.:. |::|..:||                         
  Fly   136 WAINDWVLDQTLDNVKDIIIPSDLTPDESA-VMINAAFFK------------------------- 174

Human   280 RDRSPERANGLPKATQGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRVAEGTQVLE 344
                            |.||::|...||:.::||.:.....:.:||.|.|:|: .|.:...|::|
  Fly   175 ----------------GYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGRFK-MRTSTIDQIIE 222

Human   345 LPFKGDDITMVLILPKPEKSLAKVEK--ELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFSLKEQ 407
            |||...:::||::|||...||.:.|.  |..|:::      |.||.:.|.:|:|:|:....|.|.
  Fly   223 LPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIV------LTEMDVHVQLPKFKIDFRMELVET 281

Human   408 LQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRS-LNPN 471
            |:.||:.|||:   |.....|...:....:|...||||:|::|||..|.:::|..|.|.| ...:
  Fly   282 LKSMGIQDLFN---SSSDISVLLNQSGTRISQVVHKAFIEIDEEGGSAGSASASPIRGLSDYATS 343

Human   472 RVTFKANRPFLVFIREVPLNTIIFMGRVANPCVK 505
            .|||..|.||:..||:.  :.|.|.|||.:|..|
  Fly   344 VVTFTVNSPFVFMIRDD--DNIYFRGRVVDPLKK 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 119/421 (28%)
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 116/416 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.980

Return to query results.
Submit another query.