DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn28B

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_001260209.1 Gene:Spn28B / 34035 FlyBaseID:FBgn0083141 Length:378 Species:Drosophila melanogaster


Alignment Length:433 Identity:106/433 - (24%)
Similarity:178/433 - (41%) Gaps:81/433 - (18%)


- Green bases have known domain annotations that are detailed below.


Human    84 SKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTS 148
            :...|.|...||:.|| |:|...|:..||:|.....:|..:.:...|.::|..|.||.  ..|| 
  Fly    11 TSVESGFWEDFYRILA-SQNAKRNLIYSPISAEIIMSMVYMASGGKTFEELRNVLKFS--ENKT- 71

Human   149 DQIHFFFAKLNCRLYRKANKSSK-------LVSANRLFGDKSLTFNETYQDISELVYGAKLQPLD 206
                     |....||......|       |..|||::.:|.......:..::...:.||.:.:.
  Fly    72 ---------LVANNYRSLLSDLKRRETFIILHMANRIYVNKKYCLVPEFNQLARKAFKAKAKSIR 127

Human   207 FKENAEQSRAAINKWVSNKTEGRITDVIPSEAINELTVLVLVNTIYFKVLRMALERPQGLPLALQ 271
            ..:....| |.:|.|:.|:|.|.|.:::..:..|..|...|||.||||                 
  Fly   128 LDDPVSAS-AIVNSWILNRTRGMIRNIVLPKDFNSDTSAFLVNAIYFK----------------- 174

Human   272 LTPFFFKWRDRSPERANGLPKATQGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRV 336
                                    |.|...|..:.|....||.:..|.....||..........:
  Fly   175 ------------------------GQWLYNFKADQTHIADFYVSANEIIPVKMMTLSASLLSGYI 215

Human   337 AE-GTQVLELPFKGDDITMVLILPKPEKSLAKVEKELTPEVLQEWLD-ELEEMMLVVHMPRFRIE 399
            .: ..:::|||:....::|.:|||.....|.|:::::      .::| .||:..:.|.:|:|:||
  Fly   216 DDIDAKIIELPYWNSTLSMRIILPNSVDGLRKLKEKV------GFIDYHLEKKSVNVKLPKFKIE 274

Human   400 DGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDAFHKAFLEVNEEGSEAAASTAVVIA 464
            ....||...:::|::|:|.| .:.|.|:|.|  ....:.....||||:::|:|.||:|:|.|:..
  Fly   275 SKAQLKGIFENLGILDVFKP-SADLNGLVLE--SGAKIDKIVQKAFLKIDEKGGEASAATGVLTR 336

Human   465 GRSLNPNRV----TFKANRPFLVFIREVPLNTII-FMGRVANP 502
            .:....|.:    .|.|:.||...|.:   |.:| |.|.:..|
  Fly   337 RKKSIDNLIQPPMEFIADHPFFYVIHD---NKVIYFQGHIVEP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 106/433 (24%)
Spn28BNP_001260209.1 SERPIN 17..373 CDD:238101 104/422 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 221 1.000 Domainoid score I2614
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 222 1.000 Inparanoid score I3541
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.940

Return to query results.
Submit another query.