DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SERPINC1 and Spn28Db

DIOPT Version :9

Sequence 1:NP_001373231.1 Gene:SERPINC1 / 462 HGNCID:775 Length:505 Species:Homo sapiens
Sequence 2:NP_001356884.1 Gene:Spn28Db / 326261 FlyBaseID:FBgn0053121 Length:377 Species:Drosophila melanogaster


Alignment Length:401 Identity:101/401 - (25%)
Similarity:173/401 - (43%) Gaps:78/401 - (19%)


- Green bases have known domain annotations that are detailed below.


Human   107 NIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDT-ISEKTSDQIHFFFAKLNCRLYRKANKSS 170
            |...|||.|....:|..:||...|.::|..|..... ::|         .||...|:.....|.:
  Fly    38 NFIASPLCIEIGISMILMGAKGTTAEELRSVLDLPVDVTE---------MAKKYERIMSNFQKHN 93

Human   171 KLVSANRLFGDKSLTFNETY---QDISELVYGAKLQPLDFKENAEQSRA--AINKWVSNKTEGRI 230
            .|...|.|:      .||||   ||.:.|:....:  .:.|:...|.:|  :|:..:..|:...:
  Fly    94 GLRFTNWLY------VNETYEVRQDYNTLMKSTFM--AEGKDPLSQRKASNSISFSIHRKSHKGM 150

Human   231 TDVIPSE--AINELTVLVLVNTIYFKVLRMALERPQGLPLALQLTPFFFKWRDRSPERANGLPKA 293
            ..:....  .|||..  |||||:|:                                        
  Fly   151 RTISNDHNLQINESA--VLVNTVYY---------------------------------------- 173

Human   294 TQGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRVAEGTQVLELPFKGDDITMVLIL 358
             .|.||::||.::|:.::|:....:.....||...|:||....:.| |::|:||...|::|::.|
  Fly   174 -SGAWKTRFSKKDTKLKVFHGDHNKKVYVRMMSHVGRFRIADHSYG-QIIEMPFDNSDLSMIIGL 236

Human   359 PKPEKSLAKVEKELTPEVLQEWLDELEEMMLVVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSK 423
            |.....|:.:||     :|:...:.|.|..:.|.:|:|:|:....|.|.|:.:|:..:|| ..|.
  Fly   237 PLHNTYLSSIEK-----ILRTLSESLVENNVHVELPKFKIKYQTELVESLKKLGIHLIFS-NTSD 295

Human   424 LPGIVAEGRDDLYVSDAFHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVTFKANRPFLVFIREV 488
            |.|::..| ....::...||:|:|:||.|:....::....:.:.......:||.||||:..||: 
  Fly   296 LSGLLTNG-TGAKINHVVHKSFIEINERGASTGEASDHAESIQKKTRASTSFKVNRPFVFLIRD- 358

Human   489 PLNTIIFMGRV 499
             .:|:.|.|||
  Fly   359 -KHTVYFRGRV 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SERPINC1NP_001373231.1 serpinC1_AT3 70..504 CDD:381002 101/401 (25%)
Spn28DbNP_001356884.1 SERPIN 22..368 CDD:238101 99/399 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100128
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.