DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn and Ppp1r9b

DIOPT Version :10

Sequence 1:NP_001246578.1 Gene:Spn / 46194 FlyBaseID:FBgn0010905 Length:2148 Species:Drosophila melanogaster
Sequence 2:NP_758465.2 Gene:Ppp1r9b / 217124 MGIID:2387581 Length:817 Species:Mus musculus


Alignment Length:68 Identity:19/68 - (27%)
Similarity:29/68 - (42%) Gaps:12/68 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QECVTNDGKFINNEFNDVYL-----VTILH----PIPLEAFTLQKEEVSAVKYVPYEEYRNFLSK 161
            ||.::..|:.....|.. ||     |...|    |....|:..::|:::....|||  |.||..|
Mouse   192 QEVISTIGQAFELRFKQ-YLKNPPKVVTPHDRMAPFDGSAWEEEEEDLAPPPEVPY--YNNFPGK 253

  Fly   162 EDP 164
            :.|
Mouse   254 QPP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SpnNP_001246578.1 PDZ_5 1182..1254 CDD:465518
PDZ_neurabin-like 1258..1347 CDD:467252
SMC_N <1344..1606 CDD:481474
CENP-F_leu_zip 1424..1535 CDD:463102
SAM_Neurabin-like 2050..2118 CDD:188911
Ppp1r9bNP_758465.2 Actin-binding. /evidence=ECO:0000250 1..154
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..52
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 64..163
Interaction with D(2) dopamine receptor. /evidence=ECO:0000250 100..371 19/68 (28%)
Actin-binding. /evidence=ECO:0000250 164..282 19/68 (28%)
Interaction with ADRA2A, ADRA2B and ADRA2C. /evidence=ECO:0000250 169..255 18/65 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..451 13/43 (30%)
Interaction with protein phosphatase 1. /evidence=ECO:0000250 417..494
PDZ_5 426..489 CDD:465518
PP1-binding motif. /evidence=ECO:0000250|UniProtKB:O35274 447..451
Interaction with RGS2. /evidence=ECO:0000250 480..525
PDZ_neurabin-like 493..582 CDD:467252
Interaction with TGN38. /evidence=ECO:0000250 595..816
YhaN 664..>813 CDD:443752
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.