DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinu and cldnd1a

DIOPT Version :9

Sequence 1:NP_647971.3 Gene:sinu / 46187 FlyBaseID:FBgn0010894 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_956255.1 Gene:cldnd1a / 335628 ZFINID:ZDB-GENE-030131-7568 Length:252 Species:Danio rerio


Alignment Length:262 Identity:46/262 - (17%)
Similarity:84/262 - (32%) Gaps:105/262 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 VFAFAFIVIAFATPSW--------------------------------LVSD--YRITGAKLDRL 74
            :.|..::.::..:|.|                                ..||  :|:.|.    :
Zfish    18 LLAAVYVSVSIGSPHWYRYCSPPVRAEPNATELRALQEEFLDGDFDEKTASDALFRMNGT----V 78

  Fly    75 GLWVHCFRSLPDVNDDSQRRFFVGCRWVYDP--------------------------FTTGYDEI 113
            |||..|.::..|.:            |..:|                          ..:|.|.|
Zfish    79 GLWWRCVQTPTDAH------------WYREPDPQMVMECVSFSLSQQLTPKYREPGNHNSGEDMI 131

  Fly   114 RGF------LLP-AFMIATQFFYTLAFIGMLVSAIGVLVFILCAGPDQKHFITLIKSLGYVLLGA 171
            |.:      ||| |.::...|...|.|...:..::...:||                 |.:.|.|
Zfish   132 RTYLWRCQLLLPLAALLLVLFSALLGFCACVCGSVTPALFI-----------------GLLHLLA 179

  Fly   172 GVSAAIAVIVF-AGFG--NRNGWMPEHANNWFGWSFILACVGTVLTLVASTLFL--SEAHVQHKK 231
            |:.:...|..| ||..  :|...:|:..:...||:..|..:...|.::|:.|.:  :.:|.|:..
Zfish   180 GLCSLATVCCFLAGTDLLHRVSVLPDRVDAALGWALYLMLMAAPLLMMAAALMVWAARSHGQNYA 244

  Fly   232 RI 233
            |:
Zfish   245 RM 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinuNP_647971.3 Claudin_2 44..223 CDD:372799 43/250 (17%)
cldnd1aNP_956255.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.