DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sinu and pck

DIOPT Version :9

Sequence 1:NP_647971.3 Gene:sinu / 46187 FlyBaseID:FBgn0010894 Length:247 Species:Drosophila melanogaster
Sequence 2:NP_569919.2 Gene:pck / 31101 FlyBaseID:FBgn0013720 Length:256 Species:Drosophila melanogaster


Alignment Length:220 Identity:66/220 - (30%)
Similarity:103/220 - (46%) Gaps:16/220 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RTLSGSCGVGVFVFA-FAFIVIAFATPSWLVSDYRITGAKLDRLGLWVHCFRSL--PDVNDDSQR 93
            |..:|.....:..|| |..::::|.:|.|:.| |..|.|....:|||.:||:..  |......| 
  Fly    24 RATNGVVFGAIVTFASFFVLMMSFCSPYWIES-YEETRASFKNMGLWQYCFKDFVYPKYAFLKQ- 86

  Fly    94 RFFVGCRWVYDPFTTGYDEIRGFLLPAFMIATQFFYTLAF-IGMLVSAIGVLVFILCAGPDQKHF 157
              |.||   ::.|:..|..||.:|||.:::|.|.|.|::| |..||.|:..|..|.........:
  Fly    87 --FTGC---HNIFSHEYYVIREYLLPGWLMAVQGFVTMSFIIVFLVLALLSLTIIRLPLKAVLQY 146

  Fly   158 ITLIKSLGYVLLGAGVSAA---IAVIVFAGFGNRNGWMPEHANNWFGWSFILACVGTVLTLVAST 219
            ..|:..|.|  :|..:|:.   :||.:|.|...|..||.....|..|||:.||.|..:|..:|:.
  Fly   147 EWLLVRLSY--MGTAISSLFMFLAVCIFGGCAYRRDWMMYPKFNVLGWSYALAVVTFMLLGLAAL 209

  Fly   220 LFLSEAHVQHKKRIQFKESQTRFEL 244
            :...||...:..|.:.|....:.|:
  Fly   210 ILQREARQAYDARGEQKNLVMQMEM 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sinuNP_647971.3 Claudin_2 44..223 CDD:372799 59/185 (32%)
pckNP_569919.2 PMP22_Claudin 39..211 CDD:304458 57/180 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447767
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21284
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.