DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYF6 and nau

DIOPT Version :9

Sequence 1:NP_002460.1 Gene:MYF6 / 4618 HGNCID:7566 Length:242 Species:Homo sapiens
Sequence 2:NP_476650.1 Gene:nau / 42799 FlyBaseID:FBgn0002922 Length:332 Species:Drosophila melanogaster


Alignment Length:218 Identity:93/218 - (42%)
Similarity:119/218 - (54%) Gaps:37/218 - (16%)


- Green bases have known domain annotations that are detailed below.


Human    24 PLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRK 88
            |:|:  ..||  |.:.|.||.......:..|..|.|||||||...........||.||||.||:|
  Fly    96 PVEL--DKPL--GMNMTPSPIYTTDYDDENSSLSSEEHVLAPLVCSSAQSSRPCLTWACKACKKK 156

Human    89 SAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQ 153
            |...|||||||:||||||:|:|||||.|||||.:|||||||||||||:||.|||.|:|||    |
  Fly   157 SVTVDRRKAATMRERRRLRKVNEAFEILKRRTSSNPNQRLPKVEILRNAIEYIESLEDLL----Q 217

Human   154 QEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPS----------VSDHSRGL----VITAKEG 204
            :......|          :||..:...::|.|.:.|          :|.:::.:    ..|..:|
  Fly   218 ESSTTRDG----------DNLAPSLSGKSCQSDYLSSYAGAYLEDKLSFYNKHMEKYGQFTDFDG 272

Human   205 GASIDSSASSSLRCLSSIVDSIS 227
            .|:     .|||.||:.||.||:
  Fly   273 NAN-----GSSLDCLNLIVQSIN 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYF6NP_002460.1 Basic 3..98 CDD:416335 31/73 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..63 11/31 (35%)
bHLH_TS_MRF4_Myf6 93..156 CDD:381504 47/62 (76%)
nauNP_476650.1 Basic 89..166 CDD:299793 31/73 (42%)
HLH 162..213 CDD:278439 41/50 (82%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159035
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3960
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6254
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000989
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11534
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2661
SonicParanoid 1 1.000 - - X581
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.