Sequence 1: | NP_002460.1 | Gene: | MYF6 / 4618 | HGNCID: | 7566 | Length: | 242 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001033967.1 | Gene: | twi / 37655 | FlyBaseID: | FBgn0003900 | Length: | 490 | Species: | Drosophila melanogaster |
Alignment Length: | 196 | Identity: | 44/196 - (22%) |
---|---|---|---|
Similarity: | 75/196 - (38%) | Gaps: | 60/196 - (30%) |
- Green bases have known domain annotations that are detailed below.
Human 31 SPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTD-- 93
Human 94 -----RRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQ 153
Human 154 QEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRC 218
Human 219 L 219 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
MYF6 | NP_002460.1 | Basic | 3..98 | CDD:416335 | 15/73 (21%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 31..63 | 9/31 (29%) | |||
bHLH_TS_MRF4_Myf6 | 93..156 | CDD:381504 | 20/69 (29%) | ||
twi | NP_001033967.1 | HLH | 363..413 | CDD:278439 | 17/49 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |