DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gug and AT2G47820

DIOPT Version :9

Sequence 1:NP_001261581.1 Gene:Gug / 46156 FlyBaseID:FBgn0010825 Length:2007 Species:Drosophila melanogaster
Sequence 2:NP_001189773.1 Gene:AT2G47820 / 819394 AraportID:AT2G47820 Length:805 Species:Arabidopsis thaliana


Alignment Length:457 Identity:91/457 - (19%)
Similarity:162/457 - (35%) Gaps:111/457 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 ETKKFIKGLRQFGKNFFRIHKDLLPHKDT--PELVEFYYLWKKTPGANNNRPHRRRRQSALRRNR 193
            |..||.:.....|.::|....|:| :|..  |.|:|.          :.:...:..::..::.:.
plant   370 EANKFSRRKMSKGNHYFDSLTDVL-NKVALDPTLLEL----------DEDLERKGSKEEVIKNDP 423

  Fly   194 VTRANNSNSNTP--PKKEDTPEPQTATTATAAA---TAASETASRSSPAVSKEENSSLTEDDASE 253
            .|.....:.::|  .||:...:|::.|......   |....:.:.|....:.:|..||.....|.
plant   424 PTNLEEFDDSSPNSKKKKKYLQPRSKTRKIQEVMLFTIIDTSETNSIEGCTLKELRSLPVGTGSS 488

  Fly   254 CDSDSSLTHKRDESPSRMRTRNKQQNNNSSTSSGNNTAGN--GGGNATSISSGSTGG----GAAG 312
            ..:.||...:.:::.|       :::.|.:.::..:.|..  |||   |||||.:..    .|..
plant   489 IANSSSYLSESEDNMS-------EESENKAETTAKSMASRVCGGG---SISSGKSSSVNMDNATS 543

  Fly   313 GNSSSKDQSANAVANGKRPKRGSETPDVSGGASV-DSPKTPTKAVAESSANKR---KGGKQDTPN 373
            .::.|.::.......|.||:.....|..:..:|: |..........|:.:.|:   |.||...||
plant   544 PSTISLNERQQKNRKGGRPRNPKLLPVCTKRSSLADCTLREAGCFGETQSRKKKPLKKGKHMRPN 608

  Fly   374 KKKRTEQESNEPSAHEENAIKEK----------------RKRPDSPVESMNSDSRPDSVLD---- 418
            ..|   .:.|.....||...::|                |:..|..:....|:||.|..|:    
plant   609 PLK---ADLNVVLTREERINEDKTLKLSSTSSFARDSSCRRNIDREISPERSESREDFDLNVSQI 670

  Fly   419 --DGESNTTDT-----------TTAEQQSTKDSKETVSCKEEREMVTNDL--------------- 455
              :.|::.|||           :.|||.|.:...|. .||.:...||.||               
plant   671 SLEREADGTDTVMADVVQNSESSCAEQSSVQVDVEK-QCKPQELQVTADLLPERRQSTRTRPLTT 734

  Fly   456 ----------------EAKAEE----KAIKAEALAEDSKDSAIKNMDEETNIQAPSSADTSLVDG 500
                            |.||.|    |:.|....:|:|:..:.|.:.....:.:.....| :.||
plant   735 KALEAFAFGYLGNSNKERKASEESRTKSNKKRKASEESRTKSTKRIHRHLPVSSKFRNGT-VEDG 798

  Fly   501 PN 502
            .|
plant   799 SN 800

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GugNP_001261581.1 ELM2 9..68 CDD:279754
SANT 125..172 CDD:197842 11/42 (26%)
SANT_MTA3_like 126..171 CDD:212559 11/41 (27%)
Sec_Non_Glob 344..>440 CDD:275213 29/132 (22%)
AT2G47820NP_001189773.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13859
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.