DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gug and mta1

DIOPT Version :9

Sequence 1:NP_001261581.1 Gene:Gug / 46156 FlyBaseID:FBgn0010825 Length:2007 Species:Drosophila melanogaster
Sequence 2:XP_005158917.1 Gene:mta1 / 794477 ZFINID:ZDB-GENE-131121-353 Length:617 Species:Danio rerio


Alignment Length:259 Identity:75/259 - (28%)
Similarity:119/259 - (45%) Gaps:34/259 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QGEIRVGPGHQVNDVYAKLPDYNPISSFPIDKETDERE---LEESRWSP-GVVADGDLLMFLRAA 66
            :||||||..:|.:           |:....:.|.|:||   |||..|.| ..:.:..:..||..|
Zfish   147 KGEIRVGNKYQAD-----------ITDLLKEGEEDDRELEKLEEKVWDPSNPLTEKQIDQFLVVA 200

  Fly    67 RSMAAFQGMCD-------GGLEDGCLAASRDDTTINALDVLHDSGYDPGKALQALVK--CPV-SK 121
            ||:..|....|       ..|.....|||||.|..:|:|.||.:|||..:|:.|||.  .|| .:
Zfish   201 RSVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLHKNGYDMTRAIAALVPQGGPVLCR 265

  Fly   122 GIDKKWTEDETKKFIKGLRQFGKNFFRIHKDLLPHKDTPELVEFYYLWKKTPGANNNRPHRRRRQ 186
            ...::|:..|...|.:.|.::||:|..|.:|.||.|....::|:||:||.|    :....::|.:
Zfish   266 DEMEEWSASEANLFEEALEKYGKDFTDIQQDFLPWKSLTSIIEYYYMWKTT----DRYVQQKRLK 326

  Fly   187 SALRRNRVTRANNSNSNTPPKKE---DTPEPQTATTATAAATAASETA--SRSSPAVSKEENSS 245
            :|...:::.:....|.|.|...:   ::.:|.....|.|...|..:..  .|:..:...|..||
Zfish   327 AAEAESKLKQVYIPNYNKPNPNQLSVNSVKPGLVNGAGALPGAPGQPVGLGRACESCYSESTSS 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GugNP_001261581.1 ELM2 9..68 CDD:279754 18/62 (29%)
SANT 125..172 CDD:197842 17/46 (37%)
SANT_MTA3_like 126..171 CDD:212559 16/44 (36%)
Sec_Non_Glob 344..>440 CDD:275213
mta1XP_005158917.1 BAH_MTA 3..171 CDD:240060 9/34 (26%)
ELM2 150..202 CDD:279754 18/62 (29%)
SANT 269..316 CDD:197842 17/46 (37%)
SANT_MTA3_like 270..315 CDD:212559 16/44 (36%)
ZnF_GATA 375..430 CDD:214648 4/16 (25%)
ZnF_GATA 379..437 CDD:238123 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D802091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.