DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gug and F10E7.11

DIOPT Version :9

Sequence 1:NP_001261581.1 Gene:Gug / 46156 FlyBaseID:FBgn0010825 Length:2007 Species:Drosophila melanogaster
Sequence 2:NP_001379868.1 Gene:F10E7.11 / 174170 WormBaseID:WBGene00017352 Length:239 Species:Caenorhabditis elegans


Alignment Length:274 Identity:68/274 - (24%)
Similarity:101/274 - (36%) Gaps:87/274 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 NDVYAKLPD-------YNPI---SSFPIDKETDERE-----------LEESRWSPGVVADGDL-- 59
            :|.||..||       .:|:   :..|:..|....|           ::::......|.|..|  
 Worm     8 DDDYAPPPDPWKRSIRVDPVLFQADVPLFNEATVEESAREDDTILWTIDQTNQPSDEVIDNYLKD 72

  Fly    60 LMFLRAARSMAAFQGMCDGGLEDGCLAASRDDTTINALDVLHDSGYDPGKALQAL----VKCPV- 119
            ::.||.|..    |.....|.|      ||||.  :||..|:.|.:|..||.::.    :..|. 
 Worm    73 VVGLRKAHD----QPCPPAGTE------SRDDE--DALCALYRSNFDTEKAKESFPFPHINAPFR 125

  Fly   120 -----SKGIDKKWTEDETKKFIKGLRQFGKNFFRIHKDLLPHKDTPELVEFYYLWKKTPG----- 174
                 :.|.|    |.|.|.|.:.|..:||:|..|.:..||::...||:|:||.||.|||     
 Worm   126 TVRSDALGFD----ESEAKAFEESLELYGKDFSLIRRLRLPYRKVGELIEYYYQWKLTPGYRVWR 186

  Fly   175 ------ANNNRPHRRRRQSALRRNRVTRANNSNSNTPPKKEDTPEPQTATTATAAATAASETASR 233
                  |...:||    .||....:..:..:.|..|...:....||.|:                
 Worm   187 DAHPQHAPVVQPH----LSAAWHQQAAQLEDQNGQTGFVEASFSEPSTS---------------- 231

  Fly   234 SSPAVSKEENSSLT 247
                   ||.|:||
 Worm   232 -------EEPSTLT 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GugNP_001261581.1 ELM2 9..68 CDD:279754 15/72 (21%)
SANT 125..172 CDD:197842 18/46 (39%)
SANT_MTA3_like 126..171 CDD:212559 17/44 (39%)
Sec_Non_Glob 344..>440 CDD:275213
F10E7.11NP_001379868.1 ELM2 22..73 CDD:396160 7/50 (14%)
SANT_MTA3_like 134..177 CDD:212559 17/46 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.