DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gug and Mta3

DIOPT Version :9

Sequence 1:NP_001261581.1 Gene:Gug / 46156 FlyBaseID:FBgn0010825 Length:2007 Species:Drosophila melanogaster
Sequence 2:XP_038934036.1 Gene:Mta3 / 100362346 RGDID:1306803 Length:637 Species:Rattus norvegicus


Alignment Length:262 Identity:79/262 - (30%)
Similarity:119/262 - (45%) Gaps:43/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QGEIRVGPGHQVNDVYAKLPDYNPISSFPIDKETDERE---LEESRWSP-GVVADGDLLMFLRAA 66
            :|||||||.:|     |.:||..|      :.::||||   ||...|.| ..:.|..:..||..|
  Rat   147 KGEIRVGPKYQ-----ADIPDVLP------EGDSDEREQSKLEVKVWDPNSPLTDRQIDQFLVVA 200

  Fly    67 RSMAAFQGMCD-------GGLEDGCLAASRDDTTINALDVLHDSGYDPGKALQALVKC--PV-SK 121
            |::..|....|       ..|.....|||||.|..:|:|.|:..|||...|:..||..  || .:
  Rat   201 RAVGTFARALDCSSSVRQPSLHMSAAAASRDITLFHAMDTLYRHGYDLSSAISVLVPLGGPVLCR 265

  Fly   122 GIDKKWTEDETKKFIKGLRQFGKNFFRIHKDLLPHKDTPELVEFYYLWKKTPG-ANNNRPHRRRR 185
            ...::|:..|...|.:.|.::||:|..|.:|.||.|....::|:||:||.|.. ....|......
  Rat   266 DEMEEWSASEASLFEEALEKYGKDFNDIRQDFLPWKSLTSIIEYYYMWKTTDRYVQQKRLKAAEA 330

  Fly   186 QSALRR-----------NRVTRANNSNSNTPPKKEDTP-EPQTATTATAA----ATAASETASRS 234
            :|.|::           |::: ::|..:.|......|| :||:|....|.    ||.:.:..|..
  Rat   331 ESKLKQVYIPTYSKPNPNQIS-SSNGKAGTVNGAVGTPFQPQSALLGRACESCYATQSHQWYSWG 394

  Fly   235 SP 236
            .|
  Rat   395 PP 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GugNP_001261581.1 ELM2 9..68 CDD:279754 22/62 (35%)
SANT 125..172 CDD:197842 17/46 (37%)
SANT_MTA3_like 126..171 CDD:212559 16/44 (36%)
Sec_Non_Glob 344..>440 CDD:275213
Mta3XP_038934036.1 BAH_MTA 3..170 CDD:240060 12/33 (36%)
ELM2 150..201 CDD:396160 21/61 (34%)
SANT_MTA3_like 270..315 CDD:212559 16/44 (36%)
ZnF_GATA 376..421 CDD:214648 5/21 (24%)
MTA_R1 460..536 CDD:407344
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D802091at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.