DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31195 and F39B2.8

DIOPT Version :9

Sequence 1:NP_732553.2 Gene:CG31195 / 46155 FlyBaseID:FBgn0051195 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_493572.2 Gene:F39B2.8 / 3565054 WormBaseID:WBGene00009558 Length:594 Species:Caenorhabditis elegans


Alignment Length:178 Identity:43/178 - (24%)
Similarity:61/178 - (34%) Gaps:61/178 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 VRRPYLGEIVERASAEQYYNEYDCLKIGWIQKLPIQWDKASYHIRQKYLDRHPEYRNYTTGSRSL 440
            :|||    ....:|:..|...|..:.|.::|       .:.:||...:..|:    ..|.|.:.|
 Worm     1 MRRP----TTTTSSSSSYTPWYHHIFIIFLQ-------YSLFHISPTFGARN----TVTEGGQPL 50

  Fly   441 -----------------HAEH-LNIDQALKYIHGVNY-----RTCKNFHPQDL-------ILRGD 475
                             .||| |:...|||:...:..     ...|||.||.|       |...|
 Worm    51 TELLSSLDQPYPCGHVVEAEHFLSTAVALKFPRLIQLAHFFANHSKNFDPQLLDKSSFQQIPPFD 115

  Fly   476 VSFGAKEQF--------ENEAKMAVRLANFISAFLQVSDPNEVYSGKR 515
            |||..:..|        .|..:...||. |:|     .|||.  |.|:
 Worm   116 VSFARRTHFYGLQLNCTGNNHRWLPRLV-FVS-----HDPNN--SNKK 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31195NP_732553.2 None
F39B2.8NP_493572.2 7tm_GPCRs 211..448 CDD:391938
TM helix 1 211..233 CDD:341315
TM helix 2 245..266 CDD:341315
TM helix 3 275..299 CDD:341315
TM helix 4 318..338 CDD:341315
TM helix 5 356..382 CDD:341315
TM helix 6 388..411 CDD:341315
TM helix 7 420..445 CDD:341315
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7472
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.