Sequence 1: | NP_732553.2 | Gene: | CG31195 / 46155 | FlyBaseID: | FBgn0051195 | Length: | 807 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_723730.2 | Gene: | CG31760 / 34642 | FlyBaseID: | FBgn0051760 | Length: | 1093 | Species: | Drosophila melanogaster |
Alignment Length: | 223 | Identity: | 50/223 - (22%) |
---|---|---|---|
Similarity: | 80/223 - (35%) | Gaps: | 83/223 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 632 PNSYRAANIKHGYWTQPQFDCDGYVKKWLVTY--AVPFFGWDSLKVKLEFKGVVAVSMDMLQLDI 694
Fly 695 NQCPDWYY---------------------------------------EPNAFKNTHKCDEQSSYC 720
Fly 721 --------VPIMGRG-----------YETGGYKCECLQGY---EYPFEDLITYYDGQLVEAEYQN 763
Fly 764 IVADVETRY-DMFKCRLAGASGLQSALG 790 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31195 | NP_732553.2 | None | |||
CG31760 | NP_723730.2 | FU | 486..>508 | CDD:214589 | 6/15 (40%) |
7tm_3 | 526..754 | CDD:278433 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR32546 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |