DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31195 and smog

DIOPT Version :9

Sequence 1:NP_732553.2 Gene:CG31195 / 46155 FlyBaseID:FBgn0051195 Length:807 Species:Drosophila melanogaster
Sequence 2:NP_001245881.1 Gene:smog / 33690 FlyBaseID:FBgn0051660 Length:951 Species:Drosophila melanogaster


Alignment Length:173 Identity:41/173 - (23%)
Similarity:64/173 - (36%) Gaps:31/173 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   614 IKIRHNETGEYQQKY-EHYPNSY-----RAANIKHG--YWTQPQFDCDGYVKKWLVTYAVPFFGW 670
            :|.|.|.|....|.: :.|..||     .|.|...|  .|..|..||:...::||..:.:.|   
  Fly   349 VKFRDNVTIPPDQVHNKAYLGSYWRELGAAWNSTDGTQEWGAPFRDCNLLTRRWLWPFRISF--- 410

  Fly   671 DSLKVKLEFKGVVAVSMDMLQLDINQCPDWYYEPNAFKNTHKCDEQSSYCVPIMGRGYETGG-YK 734
            ...::|:.....:|...|:       |.|...|  .|...|.||..:::|:....:...|.. |.
  Fly   411 SEHRIKVVAAAFIAADEDV-------CNDGLEE--VFGRRHGCDRNTTFCLLTENKPAATRDVYT 466

  Fly   735 CECLQGYEYPFEDLITYYDGQLVEAEYQNIVADVETRYDMFKC 777
            |.|.:.|..| ...:..:.|..||         :...||.:.|
  Fly   467 CLCRESYYLP-NSTLQGFRGDRVE---------LSEGYDNYSC 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31195NP_732553.2 None
smogNP_001245881.1 7tm_3 542..776 CDD:278433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7472
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR32546
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.