DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31195 and Gpr179

DIOPT Version :9

Sequence 1:NP_732553.2 Gene:CG31195 / 46155 FlyBaseID:FBgn0051195 Length:807 Species:Drosophila melanogaster
Sequence 2:XP_008766419.1 Gene:Gpr179 / 287657 RGDID:1560033 Length:2309 Species:Rattus norvegicus


Alignment Length:272 Identity:69/272 - (25%)
Similarity:116/272 - (42%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 GAKEQFENEAKMAVRLANFISAFLQVSDPNEVYSGKRVADKPLTEDQMIGETL--AIVLGDSKVW 541
            |.....:..|....:.|||::..||.:|         :.:..:.||....:.|  ::..||.|.:
  Rat    90 GVPPVLQRAAGTLAQAANFLNMLLQAND---------IREASVEEDVEWYQALVRSVAEGDPKAY 145

  Fly   542 SATMLWERNKFTNRTYFAPYAYKTELNTRKFKVEDLARLNKTHELYTEKKYFKFLKQRWNTNFDD 606
            .|.:.:......:....|..|  |.:..... ::||:. ||..|...|               :|
  Rat   146 RALLTFNPPPGASHLQLALQA--TRMGDETI-LQDLSG-NKVQEENPE---------------ED 191

  Fly   607 LETFYMKIKIRHNETGEYQQKYEHYPNSYRAANIKHGYWTQPQFDC-DGYVKK-WLVTYAVPFFG 669
            |::..::.::..|:............:.| ..:|:....:.|..:| :|.::. ||||.:..|:|
  Rat   192 LDSPGLQKRVLTNDLRSLDSPKWPRGDGY-VGDIQQVKLSPPFLECHEGRLRPGWLVTVSATFYG 255

  Fly   670 WDSLKVKL--EFKGVVAVSMDMLQLDINQC---PDWYYEPNAFKNTHKCDEQSSYCVPIMGRGYE 729
               ||..|  |.:|.|.:.:|:..:|||||   |.||      .|||.||..|:.|||:.|:|:.
  Rat   256 ---LKPDLTPEVRGQVQMDIDLQSVDINQCASGPGWY------SNTHLCDLNSTQCVPLEGQGFV 311

  Fly   730 TGGYKCECLQGY 741
            .|.|.|.|..|:
  Rat   312 LGRYLCRCRPGF 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31195NP_732553.2 None
Gpr179XP_008766419.1 7tm_3 392..632 CDD:278433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR32546
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.