DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31195 and gpr179

DIOPT Version :9

Sequence 1:NP_732553.2 Gene:CG31195 / 46155 FlyBaseID:FBgn0051195 Length:807 Species:Drosophila melanogaster
Sequence 2:XP_017213785.2 Gene:gpr179 / 100537469 ZFINID:ZDB-GENE-120229-1 Length:1792 Species:Danio rerio


Alignment Length:300 Identity:69/300 - (23%)
Similarity:113/300 - (37%) Gaps:106/300 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 ANFISAFLQVSDPNE----------------VYSGKRV-----------ADKPLTEDQMI----- 527
            |||::...|.|:..|                :..|.|.           ||..:.:.|::     
Zfish   122 ANFLNLIFQASELRETSVREDIEWYHALVRTMLEGDRPGLVRRAFLTFDADPTIQQPQLVLRASK 186

  Fly   528 GETLAIVLGDSKVWSATMLWERNKFTNRTYFAPYAYKTELNTRKFKVEDLARLNKTHELYTEKKY 592
            |.|..|:|.|     .|..|        |.|.|.|                         .::.:
Zfish   187 GTTQDILLQD-----LTSAW--------TSFRPPA-------------------------PDQSW 213

  Fly   593 FKFLKQ--------RWNTNFDDLETFYMKIKIRHNETGEYQQKYEHYPNSYRAANIKHGYWTQPQ 649
            |...|.        ......:||.|.         :|.::.:...:..||   :.::.|  ..|.
Zfish   214 FDIFKSSSPPLHALSKRVLLNDLSTL---------DTPKWARGDSYVINS---SGVQWG--EGPF 264

  Fly   650 FDC-DG-YVKKWLVTYAVPFFGWDSLKVKL--EFKGVVAVSMDMLQLDINQCP--DWYYEPNAFK 708
            .:| || ::..||::.::||:|   ||..|  ||:||:.|.:::....::||.  |::     |.
Zfish   265 LECVDGRFLPGWLLSLSMPFYG---LKPDLSPEFRGVIRVDVNIQGFSVDQCATGDFW-----FA 321

  Fly   709 NTHKCDEQSSYCVPIMGRGYETGGYKCECLQGYEYPFEDL 748
            |||:|:..|..|.||..:|:..|.|.|.|.:||..|..|:
Zfish   322 NTHQCNRTSMECEPIPQKGFRMGQYCCRCKKGYYSPISDI 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31195NP_732553.2 None
gpr179XP_017213785.2 7tmC_GPR158-like 405..661 CDD:320420
TM helix 1 405..430 CDD:320420
TM helix 2 442..463 CDD:320420
TM helix 3 472..496 CDD:320420
TM helix 4 516..536 CDD:320420
TM helix 5 565..591 CDD:320420
TM helix 6 599..622 CDD:320420
TM helix 7 630..655 CDD:320420
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR32546
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.