DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment l(3)02640 and hmbs

DIOPT Version :9

Sequence 1:NP_612103.1 Gene:l(3)02640 / 46140 FlyBaseID:FBgn0010786 Length:652 Species:Drosophila melanogaster
Sequence 2:XP_012821804.1 Gene:hmbs / 448096 XenbaseID:XB-GENE-5918290 Length:358 Species:Xenopus tropicalis


Alignment Length:305 Identity:163/305 - (53%)
Similarity:213/305 - (69%) Gaps:14/305 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AQEK--VIRVGSRKSELALIQTKHVIGRLQKLYPKQKFEIHTMSTFGDRVLNVSLPKIGEKSLFT 65
            |:|.  |||||:|||:||.|||..|:..|.|.:|...|:|..|||.||::|:.:|.|||||||||
 Frog    11 AEENKHVIRVGTRKSQLARIQTDSVVEMLSKRFPSTHFDIVAMSTTGDKILDTALSKIGEKSLFT 75

  Fly    66 RDLEDALRNGGVDFVVHSLKDLPTALPTGMAIGAVLEREDARDALVLRENFKGHTIASLPKGSVI 130
            ::||:||....||.||||||||||:||.|..||||.:||:..||:|......|:|:::||:.|||
 Frog    76 KELENALERNEVDLVVHSLKDLPTSLPPGFTIGAVCKRENPYDAVVFHPKRYGNTLSTLPEKSVI 140

  Fly   131 GTSSLRRTAQIRRMYPHLTVCDIRGNLNTRLAKLDAADSKFSGIILAQAGLVRMGWMSRISQVLE 195
            |||||||.||:::.:|||...|||||||||:.|||..:. ||.||||.|||.||||.:||.|:|.
 Frog   141 GTSSLRRAAQLKKKFPHLEFKDIRGNLNTRMKKLDEKED-FSAIILAAAGLRRMGWENRIGQILT 204

  Fly   196 PTDLLYAVGQGALAVECRANDDQVLAMLQKLMCLNTTCRILAERSFLKTLGGGCSAPVAVWSNLK 260
            ..:.||||||||||:|.||.|..:|:|:..|....|..|.:|||:|:|.|.||||.||||.:.:|
 Frog   205 SDECLYAVGQGALAIEVRAKDQDILSMVSALQDPETVLRCIAERAFMKRLEGGCSVPVAVNTVVK 269

  Fly   261 GEPLNGNSQEVGLSLTGAVWSLDGAIEIRNHLACALN--EQKLEG 303
                  :||   |.|||||:||||:..::..:...:|  :|::||
 Frog   270 ------DSQ---LYLTGAVYSLDGSDSLKETMQSCINFPQQEVEG 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
l(3)02640NP_612103.1 hemC 6..289 CDD:234612 157/284 (55%)
PBP2_HuPBGD_like 7..296 CDD:270363 157/288 (55%)
hmbsXP_012821804.1 PBP2_HuPBGD_like 17..296 CDD:270363 157/288 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 236 1.000 Domainoid score I2286
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H158
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1189095at2759
OrthoFinder 1 1.000 - - FOG0004130
OrthoInspector 1 1.000 - - oto103782
Panther 1 1.100 - - LDO PTHR11557
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2873
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.