DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn2 and PDF2

DIOPT Version :9

Sequence 1:NP_001261696.1 Gene:Pfdn2 / 46121 FlyBaseID:FBgn0010741 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_188887.1 Gene:PDF2 / 821819 AraportID:AT3G22480 Length:148 Species:Arabidopsis thaliana


Alignment Length:145 Identity:50/145 - (34%)
Similarity:84/145 - (57%) Gaps:8/145 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTESAKPAL----SQEAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPERKCFR 61
            |:::|....|    :::|::..::..|:|...:.:::..|||.:.||..||..::..|..|||||
plant     1 MASKSGSGGLREPPNEQAVLNMYEGKRSELSQIYSNITDLEMQVSEHSLVINAIQPLDQSRKCFR 65

  Fly    62 QIGGVLCERTVKEVLPQLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNIKIRGEHLVAEGAK 126
            .|||||.|||:|||||.:..|||.:.:.::.:...|.||..:|.:|:.::.|:|..:....||  
plant    66 MIGGVLVERTIKEVLPAVQRNKDGLEEVVRKLYETLEKKKKDLTEFEAKYKIRITKQEDNKEG-- 128

  Fly   127 GDDAEDKAENRNVLV 141
            |:..|..|:  .|||
plant   129 GNKKEGNAQ--GVLV 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn2NP_001261696.1 Prefoldin_2 13..115 CDD:280154 38/101 (38%)
PDF2NP_188887.1 Prefoldin_2 20..121 CDD:396482 38/100 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 85 1.000 Domainoid score I2832
eggNOG 1 0.900 - - E1_KOG4098
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7887
Inparanoid 1 1.050 89 1.000 Inparanoid score I2293
OMA 1 1.010 - - QHG54166
OrthoDB 1 1.010 - - D1564069at2759
OrthoFinder 1 1.000 - - FOG0004288
OrthoInspector 1 1.000 - - oto3184
orthoMCL 1 0.900 - - OOG6_102034
Panther 1 1.100 - - LDO PTHR13303
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4076
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.