DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn2 and PFDN2

DIOPT Version :9

Sequence 1:NP_001261696.1 Gene:Pfdn2 / 46121 FlyBaseID:FBgn0010741 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_036526.2 Gene:PFDN2 / 5202 HGNCID:8867 Length:154 Species:Homo sapiens


Alignment Length:140 Identity:68/140 - (48%)
Similarity:90/140 - (64%) Gaps:5/140 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SAKPALSQEAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPERKCFRQIGGVLCE 69
            :.|.|:|.|.::|.|.:||.|||.|.:....|||:|.||..||:||:..|..|||:|.:||||.|
Human    16 AGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVE 80

  Fly    70 RTVKEVLPQLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNIKIRGEH---LVAEGAKGDDAE 131
            ||||||||.|..||:.|.|.|:.:|..|..||.|||:|:|:|||::.||.   ...|.::|..| 
Human    81 RTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGA- 144

  Fly   132 DKAENRNVLV 141
             ||.:..|||
Human   145 -KASSAGVLV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn2NP_001261696.1 Prefoldin_2 13..115 CDD:280154 55/101 (54%)
PFDN2NP_036526.2 Prefoldin_2 27..128 CDD:396482 54/100 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 124..154 11/32 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147207
Domainoid 1 1.000 116 1.000 Domainoid score I5998
eggNOG 1 0.900 - - E1_KOG4098
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7887
Inparanoid 1 1.050 126 1.000 Inparanoid score I4707
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54166
OrthoDB 1 1.010 - - D1564069at2759
OrthoFinder 1 1.000 - - FOG0004288
OrthoInspector 1 1.000 - - oto90802
orthoMCL 1 0.900 - - OOG6_102034
Panther 1 1.100 - - LDO PTHR13303
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R905
SonicParanoid 1 1.000 - - X4076
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.