DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn2 and pfdn2

DIOPT Version :9

Sequence 1:NP_001261696.1 Gene:Pfdn2 / 46121 FlyBaseID:FBgn0010741 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001038754.1 Gene:pfdn2 / 323012 ZFINID:ZDB-GENE-060519-27 Length:156 Species:Danio rerio


Alignment Length:134 Identity:59/134 - (44%)
Similarity:84/134 - (62%) Gaps:15/134 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STESAKPALSQEAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPERKCFRQIGGV 66
            ||.||      |.:||.||::|.|||::.:.....||::.||..||:||:..||.|||||.:|||
Zfish    18 STPSA------EQVVATFQRMRQEQRSMASKAAEFEMEINEHSLVIDTLKEVDPSRKCFRLVGGV 76

  Fly    67 LCERTVKEVLPQLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNIKIRGEHLVAEGAKGDDAE 131
            |.|||||||||.|..||:.|:|.::.:...:..||.||.:::|.:||::.||         ||.:
Zfish    77 LVERTVKEVLPALENNKEQISKIVETLNTQMQVKGRELTEYRERYNIRLVGE---------DDKQ 132

  Fly   132 DKAE 135
            .||:
Zfish   133 GKAD 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn2NP_001261696.1 Prefoldin_2 13..115 CDD:280154 49/101 (49%)
pfdn2NP_001038754.1 Prefoldin_2 23..125 CDD:280154 49/101 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170580710
Domainoid 1 1.000 108 1.000 Domainoid score I6419
eggNOG 1 0.900 - - E1_KOG4098
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7887
Inparanoid 1 1.050 114 1.000 Inparanoid score I4819
OMA 1 1.010 - - QHG54166
OrthoDB 1 1.010 - - D1564069at2759
OrthoFinder 1 1.000 - - FOG0004288
OrthoInspector 1 1.000 - - oto41452
orthoMCL 1 0.900 - - OOG6_102034
Panther 1 1.100 - - LDO PTHR13303
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R905
SonicParanoid 1 1.000 - - X4076
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.