DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn2 and SPAC3A11.13

DIOPT Version :9

Sequence 1:NP_001261696.1 Gene:Pfdn2 / 46121 FlyBaseID:FBgn0010741 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_594190.1 Gene:SPAC3A11.13 / 2543106 PomBaseID:SPAC3A11.13 Length:114 Species:Schizosaccharomyces pombe


Alignment Length:113 Identity:33/113 - (29%)
Similarity:54/113 - (47%) Gaps:8/113 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPERKCFRQIGGVLCERTVKEVLP 77
            |.:..::|.|:.|....|.||..||..|:|:.||:..||...|:...::|||..|.:::.:|...
pombe     2 EELAKKYQNLQTELSTYVESLKKLETQLQENTTVLNELEKVAPDSNIYKQIGPTLVKQSHEEAKT 66

  Fly    78 QLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNIKIRGEHLVAEGA 125
            .:....|||.|.|..:.|.        .|..:|...|::|..:.|:.|
pombe    67 NVKTRLDFINKEIARLENQ--------TKISQEEFSKVKGAIIQAQAA 106

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn2NP_001261696.1 Prefoldin_2 13..115 CDD:280154 29/101 (29%)
SPAC3A11.13NP_594190.1 Prefoldin_beta 1..98 CDD:238345 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.