DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn2 and pfd-2

DIOPT Version :9

Sequence 1:NP_001261696.1 Gene:Pfdn2 / 46121 FlyBaseID:FBgn0010741 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_494764.1 Gene:pfd-2 / 173768 WormBaseID:WBGene00019220 Length:141 Species:Caenorhabditis elegans


Alignment Length:128 Identity:44/128 - (34%)
Similarity:73/128 - (57%) Gaps:2/128 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 TESAKPALSQE--AIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPERKCFRQIGG 65
            |.:|.||..:|  .:|.:|:.||::|:::...:..:|.:.||...|:|.::..:|::||||.|..
 Worm     6 TAAATPAEQEEQRKVVEKFKALRDQQQDIAAEVTRIEEERREFGRVLEVIKDLEPDQKCFRLISD 70

  Fly    66 VLCERTVKEVLPQLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNIKIRGEHLVAEGAKGD 128
            .|.|.|||:|:|.|..|...:....:.:.:.|.:||.|||..|..|||::..|...||..|.:
 Worm    71 TLVEYTVKDVIPDLQNNIANLTIVSKQLNDQLVEKGKELNTHKTTHNIRLLTEKESAELRKAE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn2NP_001261696.1 Prefoldin_2 13..115 CDD:280154 36/103 (35%)
pfd-2NP_494764.1 Prefoldin_2 18..120 CDD:280154 35/101 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159357
Domainoid 1 1.000 74 1.000 Domainoid score I6010
eggNOG 1 0.900 - - E1_KOG4098
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 79 1.000 Inparanoid score I3813
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54166
OrthoDB 1 1.010 - - D1564069at2759
OrthoFinder 1 1.000 - - FOG0004288
OrthoInspector 1 1.000 - - oto18312
orthoMCL 1 0.900 - - OOG6_102034
Panther 1 1.100 - - LDO PTHR13303
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R905
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.800

Return to query results.
Submit another query.