DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pfdn2 and pfdn2

DIOPT Version :9

Sequence 1:NP_001261696.1 Gene:Pfdn2 / 46121 FlyBaseID:FBgn0010741 Length:143 Species:Drosophila melanogaster
Sequence 2:NP_001120494.1 Gene:pfdn2 / 100145615 XenbaseID:XB-GENE-997342 Length:143 Species:Xenopus tropicalis


Alignment Length:143 Identity:67/143 - (46%)
Similarity:91/143 - (63%) Gaps:3/143 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTESAKPALSQEAIVAQFQQLRNEQRNLVNSLNTLEMDLREHKTVIETLEAADPERKCFRQIGG 65
            |::.:|| .::.|.:||.|.:||.|||.|.:....|||:|.||..||:||:..:..|||||.:||
 Frog     1 MASNAAK-QVAAEQVVAGFNRLRQEQRGLASKAAELEMELNEHTLVIDTLKEVEQGRKCFRMVGG 64

  Fly    66 VLCERTVKEVLPQLVENKDFIAKTIQMVTNDLSKKGSELNKFKEEHNIKIRGEHLVAEGAK--GD 128
            ||.|||||||||.|..||:.|.|.::.::..|..||.|||:|:|:|||:|.||....:..|  ||
 Frog    65 VLVERTVKEVLPALENNKEQINKILESLSTQLQTKGRELNEFREKHNIRIMGEDEAKQPPKEGGD 129

  Fly   129 DAEDKAENRNVLV 141
            ....|..:..|||
 Frog   130 SDGSKPSSAGVLV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pfdn2NP_001261696.1 Prefoldin_2 13..115 CDD:280154 54/101 (53%)
pfdn2NP_001120494.1 Prefoldin_2 12..114 CDD:366859 54/101 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 111 1.000 Domainoid score I6182
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7887
Inparanoid 1 1.050 119 1.000 Inparanoid score I4634
OMA 1 1.010 - - QHG54166
OrthoDB 1 1.010 - - D1564069at2759
OrthoFinder 1 1.000 - - FOG0004288
OrthoInspector 1 1.000 - - oto104596
Panther 1 1.100 - - LDO PTHR13303
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4076
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.