DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup214 and Thoc3

DIOPT Version :9

Sequence 1:NP_652039.2 Gene:Nup214 / 46091 FlyBaseID:FBgn0010660 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_082873.2 Gene:Thoc3 / 73666 MGIID:1920916 Length:351 Species:Mus musculus


Alignment Length:254 Identity:52/254 - (20%)
Similarity:84/254 - (33%) Gaps:87/254 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 PELKVIIVKDLVNAKSTAQQPQARLVPLPSIPNYIACSSDGNLLAVNHTQNGTSLLSIYAVLSF- 118
            |...|:.:::|....|..::..|....:.|    :|.|.||..||..               || 
Mouse    31 PSRYVLGMQELFRGHSKTREFPAHSAKVHS----VAWSCDGRRLASG---------------SFD 76

  Fly   119 MTPDVRPVYNIRLAAEDHVHG-----VQLLWNPVLPNSLAVVLSNGALAMYALK----------E 168
            .|..|..:...||..|::..|     .||.|:|..|:.......:..:.::.::          :
Mouse    77 KTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCIATVNTK 141

  Fly   169 GGNFEMHSLDKNQQVKCGCWSPKGKQIVLGFPGGTV-------------KQFKPDLTLAKTLLCP 220
            |.|..:            ||||.|:.|.:|.....|             :|||            
Mouse   142 GENINI------------CWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFK------------ 182

  Fly   221 PNIHDAPFDTIAIQWLSTFQFAVIFLQHGEDCSPSLYILNAPKAGAPSYINYYD---IC 276
                   |:...|.|.:...  :.||.:|..|   :.||:.|:......||.:.   ||
Mouse   183 -------FEVNEISWNNDNN--MFFLTNGNGC---INILSYPELKPVQSINAHPSNCIC 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup214NP_652039.2 WD40 <31..>233 CDD:225201 39/206 (19%)
WD40 repeat 38..86 CDD:293791 6/30 (20%)
WD40 repeat 90..131 CDD:293791 10/41 (24%)
WD40 repeat 139..173 CDD:293791 8/48 (17%)
Thoc3NP_082873.2 WD40 <46..329 CDD:225201 49/239 (21%)
WD40 49..290 CDD:238121 48/236 (20%)
WD 1 53..94 15/59 (25%)
WD40 repeat 59..97 CDD:293791 14/56 (25%)
WD 2 97..137 6/39 (15%)
WD40 repeat 102..139 CDD:293791 5/36 (14%)
WD 3 139..178 10/50 (20%)
WD40 repeat 145..180 CDD:293791 8/46 (17%)
WD 4 180..221 13/64 (20%)
WD40 repeat 185..221 CDD:293791 9/40 (23%)
WD 5 222..261 2/8 (25%)
WD40 repeat 227..263 CDD:293791 2/3 (67%)
WD 6 264..303
WD40 repeat 269..295 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.