DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nup214 and grwd1

DIOPT Version :9

Sequence 1:NP_652039.2 Gene:Nup214 / 46091 FlyBaseID:FBgn0010660 Length:1711 Species:Drosophila melanogaster
Sequence 2:NP_989268.3 Gene:grwd1 / 394881 XenbaseID:XB-GENE-986093 Length:466 Species:Xenopus tropicalis


Alignment Length:251 Identity:45/251 - (17%)
Similarity:87/251 - (34%) Gaps:66/251 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 QPELKVIIVK-----DLVNAKSTAQQPQARL------VPLPSIPNYIACSSDGNLLAVNHTQNGT 107
            :|:|::.:|.     :.:...:..:.|.|.:      |.:..:...::..||..:||....:...
 Frog   158 KPQLELAMVPHYGGINRIRVSTMGEVPVAAVWSEKGQVDIYDLRKQLSAVSDSQVLAAFLKEEQA 222

  Fly   108 SLLSIYAVLSFMTP----DVRPVYNIRLAAED-------------------------HVHGVQ-L 142
            .:..:::....||.    |..|....||...|                         |...|: |
 Frog   223 KIKPVFSFSGHMTEGFAMDWSPKTAGRLVTGDCNKNIHLWDPREGGTWHVDQRPFTGHTKSVEDL 287

  Fly   143 LWNPVLPNSLAVVLSNGALAMYALKEGGN-------FEMHSLDKNQQVKCGCWSPKGKQIVLGFP 200
            .|:|......|....:.::.::.::...|       .:.|..|    |....|:.:...||.|..
 Frog   288 QWSPTEATVFASCSVDASIRIWDVRAAPNKACMLTASQAHESD----VNVISWNHQEPFIVSGGD 348

  Fly   201 GGTVK-----QFKPDLTLAKTLLCPPNIHDAPFDTIAIQWLSTFQFAVIFLQHGED 251
            .|.:|     ||:..:::||.     ..|.||.  .:::|..|  .:.:|...|.|
 Frog   349 DGVLKIWDLRQFQKGVSVAKF-----KQHTAPI--TSVEWHPT--DSGVFAASGAD 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Nup214NP_652039.2 WD40 <31..>233 CDD:225201 40/231 (17%)
WD40 repeat 38..86 CDD:293791 6/42 (14%)
WD40 repeat 90..131 CDD:293791 8/44 (18%)
WD40 repeat 139..173 CDD:293791 6/41 (15%)
grwd1NP_989268.3 CAF1C_H4-bd 63..131 CDD:372002
WD40 226..>404 CDD:392136 35/183 (19%)
WD40 repeat 238..279 CDD:293791 5/40 (13%)
WD40 repeat 284..324 CDD:293791 6/39 (15%)
WD40 repeat 332..370 CDD:293791 10/42 (24%)
WD40 repeat 376..417 CDD:293791 5/24 (21%)
WD40 repeat 437..463 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.